SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108804362|ref|YP_644299.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804362|ref|YP_644299.1|
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily L21p-like 2.75e-27
Family Ribosomal protein L21p 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108804362|ref|YP_644299.1|
Sequence length 95
Comment 50S ribosomal protein L21 [Rubrobacter xylanophilus DSM 9941]
Sequence
MYAVVKSGGKQYRVRQGDELLVERLAGEVGDRVELPVSLRAEEGVLDLEPRTARAEILEH
LRGEKLKVYKYKPKKGYRRKKGHRQALTRIRVVEV
Download sequence
Identical sequences Q1AVU1
gi|108804362|ref|YP_644299.1| 266117.Rxyl_1525 WP_011564504.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]