SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108804451|ref|YP_644388.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804451|ref|YP_644388.1|
Domain Number 1 Region: 92-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-39
Family Phosphate binding protein-like 0.00065
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.93e-23
Family LysR-like transcriptional regulators 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108804451|ref|YP_644388.1|
Sequence length 311
Comment LysR family transcriptional regulator [Rubrobacter xylanophilus DSM 9941]
Sequence
MRLRFLEAFCAAVEEGSISGAARRMYLAQPSVSERLAELEREARVPLLVRSRRGVEPTEQ
GRLLYERARRVLDEVERVEEVLRSLRVRREARLYVAASSTLGEHLFPAWLRGFRERHPGV
IPEVFVGNTKEVVALVGRGTVAFGVIEGGEVRGPLESVPLLEDELVVVVRPGHPWARRGV
RPQELSREPFISREKGSGTREVVERAISDRGLSLDVRMELGSTSAIKEAIEAGLGFSLLS
REAIRLELGAGHLAVARGFSVSRRFTLIRNPSAELNATEQGFCDYLLGICRLSGGRRSAS
AGARRLDVHRR
Download sequence
Identical sequences Q1AVK2
WP_011564593.1.70533 gi|108804451|ref|YP_644388.1| 266117.Rxyl_1614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]