SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108804556|ref|YP_644493.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804556|ref|YP_644493.1|
Domain Number 1 Region: 44-320
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.03e-56
Family L-arabinose binding protein-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108804556|ref|YP_644493.1|
Sequence length 329
Comment periplasmic binding protein/LacI transcriptional regulator [Rubrobacter xylanophilus DSM 9941]
Sequence
MRVVKWVFVLAVMLVALVGCGQQGGQQEGQGGEGSEKGLVPREEINIEFVTHASPDPFWS
VVQNGVNQAAEDMGVEVNYRELDSYDIPQLQRNLEAAIAAEPDGMVVSIPDPDALNDKIR
EATESGIPVVVINAGENDWRDVGALTYVGQTEYDAGVAAGERMAQAGVQSAICINHEQGN
ITLDQRCNGFEKGLGGQVKQVAVQPDPTAARNGIKTALRQNPDVDGLLTLNPGIADQALR
ALEESGRSGDVTFATFDLSPSVLRAVSRGEMLFATDQQQWLQGYLPIVLLTNYIQYGVRP
VNTEIPTGPAFITKENAEQVIELSRQGIR
Download sequence
Identical sequences Q1AV97
266117.Rxyl_1721 gi|108804556|ref|YP_644493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]