SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108804802|ref|YP_644739.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804802|ref|YP_644739.1|
Domain Number 1 Region: 17-120
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.85e-23
Family Siroheme synthase N-terminal domain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 118-176
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.00000000000000419
Family Siroheme synthase middle domains-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|108804802|ref|YP_644739.1|
Sequence length 194
Comment precorrin-2 dehydrogenase [Rubrobacter xylanophilus DSM 9941]
Sequence
MDATREKKIGSDNSVLYPVFMNLRGRRCVVVGAGGVASRKARRLLQAQAEVVVVAPEVSP
ELEGIAHEVRRRPYRTGDLEGAFIAFAATGSREVNEAVAREGRRLGVPVNVADDPGGGDF
ALPSALRRGRLQVAVSTGGASPALAREIRGRLEGLFGPEWAGIVEELWRARRDGRAPDER
LQEEVSRCLSRLRA
Download sequence
Identical sequences Q1AUK1
gi|108804802|ref|YP_644739.1| 266117.Rxyl_1980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]