SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108804804|ref|YP_644741.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804804|ref|YP_644741.1|
Domain Number 1 Region: 8-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-46
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 271-361
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 9.35e-19
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0036
Further Details:      
 
Domain Number 3 Region: 178-264
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000027
Family Elongation factors 0.0015
Further Details:      
 
Domain Number 4 Region: 557-607
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000299
Family C-terminal fragment of elongation factor SelB 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108804804|ref|YP_644741.1|
Sequence length 612
Comment selenocysteine-specific translation elongation factor SelB [Rubrobacter xylanophilus DSM 9941]
Sequence
MGERPVALTIGTAGHVDHGKTTLVRRLTGTDTDRLEEEHRRGISIVPGYAELVLPGGRRA
SLVDVPGHERFVKNMVAGSTGVDAFLLVIAADDGVMPQTREHLDVLRVLGVERGVVALTK
IDAVDAETAELARLEAEEFLEESGVRAPIVPVSGVTGEGVDELLAALDELAGSPAARPAS
GLARLPVDRAFVLKGIGLVVTGTLWSGSIRVGDTLYTSSGLRPRVRGIQNHGRPAEVAYP
GARTALDLAGVEAQEIEPGEVLLSRPVPATGLFDARVRLLESARPLRHGTRVRLHHGTRS
VNARVRLLGGGELEPGSDALARVRLEEPLVALPKDRFVLRSLTPQVTIGGGTVLDIAPSG
RRPDREWLETLESGDLGRIVPRALARAGGGMAAEDLALVLGREPGEVAEAAGRAPEVVRA
GPVYALRGAVEEAKGRLLEALRRRAREHPESPELSVAEARQATGLPDALADALLEELSGG
VVRVSGQGVLLPEAAGVPPELEAEARRILERLRAAGHEPPALEPGPALALLLRRGEVVRL
SEKMYAAGEAAASVMDEIKAVCREEGEISLARLRDRLGTSRKYAQAWLEYADAQKITVRT
GDVRVLTRKHRR
Download sequence
Identical sequences Q1AUJ9
WP_011564944.1.70533 266117.Rxyl_1982 gi|108804804|ref|YP_644741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]