SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108804861|ref|YP_644798.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804861|ref|YP_644798.1|
Domain Number 1 Region: 516-827
Classification Level Classification E-value
Superfamily Aldolase 8.24e-81
Family HMGL-like 0.00000102
Further Details:      
 
Domain Number 2 Region: 84-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.42e-71
Family BC ATP-binding domain-like 0.00000691
Further Details:      
 
Domain Number 3 Region: 1-111
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-41
Family BC N-terminal domain-like 0.0000381
Further Details:      
 
Domain Number 4 Region: 824-991
Classification Level Classification E-value
Superfamily post-HMGL domain-like 2.86e-39
Family Conserved carboxylase domain 0.0026
Further Details:      
 
Domain Number 5 Region: 334-450
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.92e-37
Family BC C-terminal domain-like 0.00011
Further Details:      
 
Domain Number 6 Region: 1047-1124
Classification Level Classification E-value
Superfamily Single hybrid motif 4.45e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108804861|ref|YP_644798.1|
Sequence length 1128
Comment pyruvate carboxylase [Rubrobacter xylanophilus DSM 9941]
Sequence
MLRKVLVANRGEIAIRAFRAAYELGIRTVAVYTPDDRASMHRQKADEAYEIGEPGHPVRA
YLDIGALVGTAARVGADAIYPGYGFLSESAKFAAACEEAGITFVGPPPEVLSLTGDKVRA
REAAREAGVPVLRASGPVATAEEALAAAEEVGYPVFVKAAGGGGGRGLRMVRRARDLPGA
VQTAMREAQAAFGNPTVFLEQALEHPRHIEVQILGDAGGEVIHLFERDCSVQRRHQKVLE
MAPAPNLDPQLRERLCEDAVRFGRAVGYRNAGTVEFLVGEDGSHVFIEMNPRIQVEHTVT
EETTDVDIVHAQLRIAGGETLADLGLRQEEIRQRGVALQCRVTTEDPAQGFRPDTGRISV
YRSPGGAGIRLDGGNSFAGAEVTPYFDSLLVKLTTRGPDLAAAARRARRALAEFRVRGVA
TNIAFLRAVLDDPDFLAGRIDTSFIDRRPHLTAVGTGRDRASRLLSLLADVTVNRPHGPP
PDLPDPRGKLPPLPSADPPAGSRQRLRELGPEGFARWMREERRVLVTDTTLRDAHQSLLA
TRMRTFDMLAAAPHIARRLPALLSAEVWGGATFDVALRFLHEDPWERLARLREAMPNVCL
QMLLRGQNVVGYTRYPPEVVRAFVEEARSTGIDIFRIFDANNDVEQMRGAIEAAAEAGAL
AEGCLCYTADLSDPDEPLYTLDYYLRLAEGLVEAGCHVLCIKDMAGLLRAPAARALVGAL
RERFDLPVHLHTHDTSGGQLATYLAAIEAGVDAVDGAAAPLSGMTSQPSLSAIVAATEHT
ARATGLSLDALGDMEPYWEAVRSLYAPFEAGLRSPTGTVYRHEIPGGQLSNLRQQAISLG
LGDRFEEVEEYYARCDRLLGRLVKVTPTSKVVGDLALYLLSAGVDPEEFARDPGSYDLPE
SVIGFLRGDLGDPPGGWPEPLRTRALSGRSLPKEDGALSGEDLKALSAEEGRREALNRLM
LPGPAREQKQAEERYGDVSVIPSRAFLYGLETGEELAVDLEPGVRLYVRLEAITEPDEQG
IRTLMMTLNGQPRPVDARDRSLAPEAPAREKADPSEPGHVAAPMSGVVSLAVREGQAVEE
GEEIGSIEAMKMESAIRSPLSGTVRRIAVLPGTNVEPGDLLVVISGGG
Download sequence
Identical sequences Q1AUE2
WP_011565001.1.70533 266117.Rxyl_2041 gi|108804861|ref|YP_644798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]