SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108805331|ref|YP_645268.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108805331|ref|YP_645268.1|
Domain Number 1 Region: 42-108
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000745
Family NfeD domain-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108805331|ref|YP_645268.1|
Sequence length 117
Comment hypothetical protein Rxyl_2539 [Rubrobacter xylanophilus DSM 9941]
Sequence
MVALLQEQSGAAVFYIAALALFVLLLAAGAAAYAAFRASGGRAATGLEGMVGKRGVVRRR
VDGSAEGAVFVHGELWRAVPEEGVPPLAPGARVEVTGFRGMTLVVRPADEEDRVSPP
Download sequence
Identical sequences Q1AT22
266117.Rxyl_2539 gi|108805331|ref|YP_645268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]