SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108805454|ref|YP_645391.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108805454|ref|YP_645391.1|
Domain Number 1 Region: 38-182,220-392
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 4.45e-80
Family Acetamidase/Formamidase-like 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108805454|ref|YP_645391.1|
Sequence length 393
Comment formamidase [Rubrobacter xylanophilus DSM 9941]
Sequence
MGENGRCRLWRSAFLQGGTQVREHVIEIDPSRPLAEEPGRGHNRWHEAIEPVLEVEPGDL
VVYETRDAFDGQLGPGSTDRDVGGLDLGPVHPLTGPVYVRGAEPGDLLEVELVGIEADPW
EGWGYTVEVPGFGFLRDHFPEPYIVHWRLHEGYAESEQLPGVRIRYNPHPGVFGVAPSAE
LRRRAAEREAEAAEAGGFALPPEPAGAVPSGEPVASEGLRTVPPRENAGNIDIKQFSPGT
TMLIPVHAEGALVSTGDVHFAQGDCEACGTAIEMRSRVRVRFGLRKGEAERRGIRDLQFF
RDTYFTAPELAVPRRFYATTGICVEGEGANHSEDLTLAARNALLNMIGHLETRGFDRRQA
YALCSVAVDLRISQTVDVPNLLVSALLPLDIFV
Download sequence
Identical sequences Q1ASP9
gi|108805454|ref|YP_645391.1| 266117.Rxyl_2662 WP_011565588.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]