SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108805670|ref|YP_645607.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108805670|ref|YP_645607.1|
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000136
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0095
Further Details:      
 
Domain Number 2 Region: 79-146
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 0.0000000000000116
Family C-terminal domain of arginine repressor 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108805670|ref|YP_645607.1|
Sequence length 159
Comment ArgR family transcriptional regulator [Rubrobacter xylanophilus DSM 9941]
Sequence
MAMASAPVDKSTRQNLILRLISERDLGTQQDVVRALAEEGVEVAQATVSRDLAELGVLKV
GNRYLALPHEPGSASIEVLPSFVLGLTPAQNLVVIHTRDGTAGAVSSVLDRVKGLKIVGT
IAGQDTVLAVTPDSAAAEEVASLIADVCRAKTRPAGSVE
Download sequence
Identical sequences Q1AS33
2005153875 266117.Rxyl_2884 gi|108805670|ref|YP_645607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]