SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89900075|ref|YP_522546.1| from Rhodoferax ferrireducens T118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89900075|ref|YP_522546.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.15e-40
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 162-314
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.06e-30
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00059
Further Details:      
 
Domain Number 3 Region: 316-414
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 2.09e-20
Family Glutamyl tRNA-reductase dimerization domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89900075|ref|YP_522546.1|
Sequence length 419
Comment glutamyl-tRNA reductase [Rhodoferax ferrireducens T118]
Sequence
MAVWTLGINHTTAPLDLRGRFAFALDQVEPTLRALRGSLSRQPEAALISTCNRTEIYCAG
EKPELEHTLDWLAQTGGVSSSLLRTHSYTLQDDLAARHAFRVASGLDSMVLGETQILGQI
KNAVRAAEAAGALGNTLSQLFQRSFAVAKEVRSSTEIGAHSISMAAAAVRLAGQLFEDLG
QVKILFVGAGEMIELCATHFAAKSPKAIAIANRSLENGEKLASRFGAEVMRLADLPDRLH
EFDAVVSCTASTLPIIGLGAVERALKRRKRRPMFMVDLAVPRDIEIEVKALEDVYLYTVD
DLASVVQTAQASRQAAVAQAEAIVDAGVLSFMHWVDQRGSVPLIQQLNAQADEWRAAELA
RARKLLAKGEDVEAVLEALSKGLTQKMLHGAMTELRASDTAARERASAAIQHFFLRKER
Download sequence
Identical sequences Q21YY8
338969.Rfer_1281 WP_011463583.1.86502 gi|89900075|ref|YP_522546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]