SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_16879 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  RO3T_16879
Domain Number - Region: 33-66
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.017
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RO3T_16879
Sequence length 119
Comment | RO3G_16880 | Rhizopus oryzae hypothetical protein (120 aa)
Sequence
MAAVSFLETANLVGLGLSADKVISHVEDLKESSITKPNNHNNNGLKLMNDVVDSSYRAVF
DGINKLWQRNSSSNKAQENGPITKFLEMKSVDELKIGEVTELLADYKRLAAIIKQAGLA
Download sequence
Identical sequences I1CUN9
RO3T_16879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]