SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387904487|ref|YP_006334825.1| from Burkholderia sp. KJ006

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387904487|ref|YP_006334825.1|
Domain Number 1 Region: 42-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.3e-26
Family C-terminal domain of adrenodoxin reductase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387904487|ref|YP_006334825.1|
Sequence length 494
Comment oxidoreductase [Burkholderia sp. KJ006]
Sequence
MTATPDTLAALEARVAQDLRWLDLPPPSWVPPREVDGARVLDVAIVGGGMAGLAASAELR
LLGIDNQCVIDRAPAGYEGPWVTFARMETLRSPKQLAGPALGLPALTFRAWFEACHGRDA
WDALYKIPRTQWMDYLRWYRRVLDLSVHNDTTLVALRPRDDGLLALDLQASGATRTVLAR
HVVLATGRDGLGGPYVPPVAQRVPRTRWAHSSEPIDFAALASKRVGVVGAGASAFDNAGT
ALEAGAARVDLLFRRADIPRINKLTGIGSPGLVHGFAALDDATKWRFMHYALTSQTPPPR
ESVLRVSRHPHAYFHAASPIETLVDAHDGLQVVTPRGRYTVDFLIFATGFHSDWTTRTEF
ASFGPHVRRWKDRYQPPPGTWLDELAESPDLGPAFAFQERERGACPAVTRIHCFNNAASL
SHGKLSGDIPAISAGAGRLARGIASRLFDDDRDRHYDALVAFANAELHGDEWRDADAWTA
PSTTPVTTGTHHDD
Download sequence
Identical sequences A4JL77 I2DTW8
gi|134292759|ref|YP_001116495.1| WP_011881387.1.22835 WP_011881387.1.40662 WP_011881387.1.48957 WP_011881387.1.62776 WP_011881387.1.85080 WP_011881387.1.86980 gi|387904487|ref|YP_006334825.1| 269482.Bcep1808_4049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]