SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387904604|ref|YP_006334942.1| from Burkholderia sp. KJ006

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387904604|ref|YP_006334942.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.62e-107
Family FMN-linked oxidoreductases 0.00000000207
Further Details:      
 
Domain Number 2 Region: 335-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000015
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.06e-26
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387904604|ref|YP_006334942.1|
Sequence length 677
Comment 2,4-dienoyl-CoA reductase [Burkholderia sp. KJ006]
Sequence
MTTAFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLADYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLMTSAGARRHRVITDAVHAHDGKIALQILHTGRYGYHPFAVAPS
KIKSPISPFAPHELSARGVERQIRAFVRCAQLAREAGYDGVEIMGSEGYLINQFISMHTN
KRTDQWGGAYENRIRLPIEIVERTREAVGRDFILIYRLSMLDLIPDGSDWSETVQLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTQKMKGEVGIPLVTTNRINRPEVAEQ
ILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGCNQACLDHAFKNKIASCLLNP
RACHETELVYTPVRQPKRIAVVGAGPAGLACSTVLAQRGHRVDLFDAAAQIGGQFNMARR
IPGKEEFDEALRYFGRQIEVTGVTLHLNRRVDARELIDGGYDEIVLATGVTPRDPKIPGQ
DGPNVLSYIDVLAGRQPVGRRVAVVGAGGIGFDVAEYLVQGGQSPTLDLDEWKAEWGVTD
PAVTRGGVTRARVAAPAREVTLLQRKPAPLGKGLGKTTGWIHRATLKMKQVKMIGGVNYE
RIDARGLHVSYGEQRSDHELIEADTIVLCAGQEPQRALLAPLQAAGRSVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences A0A132E3A6 I2DU85
gi|387904604|ref|YP_006334942.1| WP_014724575.1.100586 WP_014724575.1.58403 WP_014724575.1.62776 WP_014724575.1.66494 WP_014724575.1.82744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]