SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM02673 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM02673
Domain Number 1 Region: 37-146
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.93e-27
Family Barwin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM02673
Sequence length 147
Sequence
MMAVFLHPLLHPTLVVYYSHLVKMHRPTAVRLFATLLFALFALTVNAAPIEKRASYSGDA
TFYEVGLGSCGQTNSDDEMVVALSSELMGSGNYCGKSINVKSDSGSVTVKVVDTCPSCSK
TNLDLSPAAFKKLGDLSEGRIAVTWSI
Download sequence
Identical sequences RhzM02673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]