SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM05486 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM05486
Domain Number 1 Region: 85-152
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.57e-31
Family Cyanase C-terminal domain 0.0000861
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000013
Family SinR domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RhzM05486
Sequence length 152
Sequence
AHLKLSTLHSRLFKAKAERKLSFEDIGKKIGRDEVYVAAIFYGQAKPNDEELEKLSAVLN
LPVSHLKDDLGEHFYPDRGGLMSIPPTDPVLYRFYEMLQVYGYPLKAVIHEKFGDGIMSA
IDFTAKVDKVEDPKGDRVKITLDGKFLPYKKW
Download sequence
Identical sequences RhzM05486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]