SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RhzM07550 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM07550
Domain Number 1 Region: 297-572
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000131
Family Tropomyosin 0.0006
Further Details:      
 
Domain Number 2 Region: 570-772
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000177
Family Tropomyosin 0.004
Further Details:      
 
Weak hits

Sequence:  RhzM07550
Domain Number - Region: 890-967
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000405
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RhzM07550
Sequence length 1614
Sequence
MADHESEEARKAKVLAARKKLKKFQSKKQEGTATITPETSPASPQPEPDTSAQETTTTQV
EGTSQVTSSNVTTAETETSTSTTATTTDVKNDNNTDSETTTIEQLQKQLEAKTLHEYAQL
QAQHGAKLKELDQLREKQSSLESAAKVAEETTAQLRQELQKKQNLLDERIQDLMKQLDDA
NSKATQAEDASKSKDASIAELEKKHKEIIDAMQRETETLRSELSSHQERSNQAESTAQET
ISKLQAELEQAKKAHGQIQNLTDQLEKANQEITRMTETLASKDAGAAELEKKHKEAMQAV
QKEAENIRNELDQHRHAAETASKTADETISQLRQELEAKKDLENHIQKLSIEIDQAQKTI
AELNETIAAKSSDVIELESTYREKLYTATKELETLRRELNDHQQSSENAAKTAQETIAQL
RQELQTKADVEERIQAVTKELEDAKQTITRNQSDASETERRLRESLDESKQQAENARKEL
TAVKESLRTLNDQKATLENQLQETKNDLETAKKQATSLQDKLSTKETELEEAQEDKNALQ
IDLDAAKKSLESAQADITSLKQQLASKHHELEQAKQQHGEAFEKLKGEKASAREEIAQLS
EKRQQLEQANSSYETTANQLSKEKQEIESRLNAAQKELEIVQAEITSVKEQLSNKHQELE
KAKSSHTTAANQLQYEKKALQDQLDSVQRELETVQTEIASVEEQLSNKHEELERAKSSHQ
EEVKQLKDEKAALQTRLDTVNKEMETAKSDIDMLKEQISQVSKELEAAKAKHTKDVEKIQ
QEKQAVTKELEQARERHSKEKEMASSTIEQLKQQVAMKETLEQQVQELSKQLEDARTDMT
SMQQLLTDKDNNAKDLVTKHESALATMQQEMDTLRKEIDQWSSKSEKQVQEVNSAQETIA
QLRQAKDSLDERIKTLTSELENAHADISSLNVSISENDKLAASAEAKHKEAMETLRAEMN
ALEEQLSMSRKSLEQDLLEARTRMDVLEQEKQTLQSDLEAARQKGQEQETSIKQQLEKIA
ADLEKERARSQGLDKELEQLKTNMSDREKELQQKLSEAEVQLETLKKAVQDKEEMINGLV
TESTTYKQKYDKAYMDKETIQEELASLQTALSEAQEKHKEFEAISVQKLNEAHRNLEESG
EALKKSSQEFEKYKEKSVQDLAEKTAALETLEKMVEHERAKAAKLKEMYEHKLKQASDEM
ESLKSSNTDLDRRVASMETEHKQAQAILEDRMKAAIANHEKQLAEWQEKHGNIGKDLEAQ
QFLVQKLTETKQSIEQALREAQDAFAKEQQRTMDLEKEFRSLTQQRSDIERELSAKNERV
AELEQQLEDVSKQKEEQKQASNAEKDRRAGMQKMAQENRQLQVQLEQVNGELQKRNELID
KLRKQMDEAKTAIGSEMDSLKQEIATLQKRLQAKNGGGGGEQGLVEDLEKQLAQEREKRQ
EKENALNELQTRLERQYGAFNTIRGELTNVRQRQYDNESRWTREKKELEMLLQRLRVEYE
GHLERLWMQQQTERQQHEETMENRRVALDNAQVKLMMNGLSPVSENGFEWVQSGEEEEEE
EQEEGGEYAEQERGKRAAARIPAVGKLPPLVKPAFFEFLEVPRCSGCKSEVIDI
Download sequence
Identical sequences RhzM07550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]