SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RhzM09670 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM09670
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.69e-23
Family Phosphate binding protein-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM09670
Sequence length 297
Sequence
MAIRIGYVPEHFSTPLLMARDKGFFSENGVSVELVCCPGGTGEMTQKLKSKEIDIAVALT
EGLVAGISQGHDWYKIVGTYVDAPLCWAISTGANSKHGSVDTLNKTNVAISRFGSGSHIM
AYVLADQQGWLGKDEEPFTFSALNNFQAMRDAVNADKCDYFMWETFTTKPYHDSGEVKRI
GQITPPWPAFLFAAHTDLIRDRSKDIKKVFRATEKASALFMEQKENESVQLVMNNLGYKE
EDVRNWFKTVHYAAEQSHVSRSALQTTITTLLRAKVVSAPGPSPENLIDASVTVLSQ
Download sequence
Identical sequences RhzM09670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]