SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21282181|ref|NP_645269.1| from Staphylococcus aureus subsp. aureus MW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21282181|ref|NP_645269.1|
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily YjgF-like 4.71e-46
Family YjgF/L-PSP 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21282181|ref|NP_645269.1|
Sequence length 126
Comment hypothetical protein MW0452 [Staphylococcus aureus subsp. aureus MW2]
Sequence
MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNVDGEIVSADVQAQTKQVLENLKVVL
EEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCVEVARLPKDVKVEIELV
SKIKEL
Download sequence
Identical sequences A0A0H3K219 A0A181I4J5
196620.MW0452 282459.SAS0454 gi|21282181|ref|NP_645269.1| gi|385780762|ref|YP_005756933.1| WP_000691767.1.100335 WP_000691767.1.100665 WP_000691767.1.101330 WP_000691767.1.101406 WP_000691767.1.101511 WP_000691767.1.101598 WP_000691767.1.102066 WP_000691767.1.102070 WP_000691767.1.10583 WP_000691767.1.11228 WP_000691767.1.13303 WP_000691767.1.1457 WP_000691767.1.15241 WP_000691767.1.15601 WP_000691767.1.15753 WP_000691767.1.16455 WP_000691767.1.16467 WP_000691767.1.17050 WP_000691767.1.17289 WP_000691767.1.18527 WP_000691767.1.18567 WP_000691767.1.18968 WP_000691767.1.19022 WP_000691767.1.19399 WP_000691767.1.19575 WP_000691767.1.19788 WP_000691767.1.20649 WP_000691767.1.20661 WP_000691767.1.20690 WP_000691767.1.21621 WP_000691767.1.22861 WP_000691767.1.23580 WP_000691767.1.23902 WP_000691767.1.23944 WP_000691767.1.2434 WP_000691767.1.24503 WP_000691767.1.25095 WP_000691767.1.25633 WP_000691767.1.26346 WP_000691767.1.2674 WP_000691767.1.2718 WP_000691767.1.28866 WP_000691767.1.28915 WP_000691767.1.29315 WP_000691767.1.29716 WP_000691767.1.29826 WP_000691767.1.30458 WP_000691767.1.30496 WP_000691767.1.30911 WP_000691767.1.31204 WP_000691767.1.31212 WP_000691767.1.31426 WP_000691767.1.31505 WP_000691767.1.31621 WP_000691767.1.33172 WP_000691767.1.3341 WP_000691767.1.33640 WP_000691767.1.33765 WP_000691767.1.33966 WP_000691767.1.34080 WP_000691767.1.34280 WP_000691767.1.34334 WP_000691767.1.3448 WP_000691767.1.35307 WP_000691767.1.36932 WP_000691767.1.37075 WP_000691767.1.37503 WP_000691767.1.38390 WP_000691767.1.38422 WP_000691767.1.38435 WP_000691767.1.38862 WP_000691767.1.38960 WP_000691767.1.39324 WP_000691767.1.39384 WP_000691767.1.39494 WP_000691767.1.40082 WP_000691767.1.40299 WP_000691767.1.40472 WP_000691767.1.41458 WP_000691767.1.42230 WP_000691767.1.42286 WP_000691767.1.43331 WP_000691767.1.43530 WP_000691767.1.43683 WP_000691767.1.43851 WP_000691767.1.44095 WP_000691767.1.44899 WP_000691767.1.45132 WP_000691767.1.45492 WP_000691767.1.45620 WP_000691767.1.45833 WP_000691767.1.46021 WP_000691767.1.46195 WP_000691767.1.46259 WP_000691767.1.46289 WP_000691767.1.46389 WP_000691767.1.46676 WP_000691767.1.47105 WP_000691767.1.47493 WP_000691767.1.47541 WP_000691767.1.47629 WP_000691767.1.48057 WP_000691767.1.48335 WP_000691767.1.49444 WP_000691767.1.50556 WP_000691767.1.5108 WP_000691767.1.51365 WP_000691767.1.53323 WP_000691767.1.53418 WP_000691767.1.54094 WP_000691767.1.54446 WP_000691767.1.55784 WP_000691767.1.55985 WP_000691767.1.57196 WP_000691767.1.57338 WP_000691767.1.5749 WP_000691767.1.57723 WP_000691767.1.58035 WP_000691767.1.58321 WP_000691767.1.58419 WP_000691767.1.58538 WP_000691767.1.58686 WP_000691767.1.59329 WP_000691767.1.61009 WP_000691767.1.61224 WP_000691767.1.61897 WP_000691767.1.62437 WP_000691767.1.63068 WP_000691767.1.63215 WP_000691767.1.64304 WP_000691767.1.64400 WP_000691767.1.64631 WP_000691767.1.64994 WP_000691767.1.65046 WP_000691767.1.6612 WP_000691767.1.67447 WP_000691767.1.68139 WP_000691767.1.69179 WP_000691767.1.69239 WP_000691767.1.703 WP_000691767.1.71182 WP_000691767.1.71416 WP_000691767.1.71466 WP_000691767.1.7158 WP_000691767.1.71780 WP_000691767.1.72478 WP_000691767.1.72816 WP_000691767.1.73444 WP_000691767.1.74155 WP_000691767.1.74273 WP_000691767.1.74761 WP_000691767.1.74840 WP_000691767.1.74846 WP_000691767.1.76149 WP_000691767.1.76820 WP_000691767.1.77460 WP_000691767.1.77485 WP_000691767.1.78598 WP_000691767.1.7868 WP_000691767.1.79270 WP_000691767.1.79664 WP_000691767.1.81010 WP_000691767.1.81097 WP_000691767.1.81344 WP_000691767.1.81767 WP_000691767.1.83066 WP_000691767.1.83652 WP_000691767.1.84943 WP_000691767.1.85160 WP_000691767.1.85231 WP_000691767.1.85292 WP_000691767.1.8551 WP_000691767.1.85555 WP_000691767.1.86248 WP_000691767.1.86606 WP_000691767.1.87272 WP_000691767.1.87782 WP_000691767.1.88311 WP_000691767.1.88560 WP_000691767.1.88753 WP_000691767.1.88761 WP_000691767.1.8986 WP_000691767.1.9055 WP_000691767.1.9071 WP_000691767.1.90923 WP_000691767.1.92055 WP_000691767.1.92115 WP_000691767.1.92479 WP_000691767.1.92918 WP_000691767.1.92960 WP_000691767.1.93237 WP_000691767.1.93272 WP_000691767.1.93736 WP_000691767.1.9544 WP_000691767.1.96682 WP_000691767.1.96882 WP_000691767.1.97019 WP_000691767.1.97444 WP_000691767.1.97466 WP_000691767.1.97484 WP_000691767.1.97717 WP_000691767.1.98191 WP_000691767.1.98497 gi|49485361|ref|YP_042582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]