SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21283846|ref|NP_646934.1| from Staphylococcus aureus subsp. aureus MW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21283846|ref|NP_646934.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.02e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21283846|ref|NP_646934.1|
Sequence length 103
Comment PTS system, lactose-specific IIA component [Staphylococcus aureus subsp. aureus MW2]
Sequence
MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
Download sequence
Identical sequences A0A0D1ILT6 A0A0E1AJ56 A0A0E1VNG0 A0A0E1XEG1 A0A0H2XG51 A0A0H3KEB3 A0A1E8WUB4 P0A0D3 P0A0D4 P0A0D5 P0A0D6 Q2G2R5 Q5HE14 Q6G7C3 Q6GEN8 T1YCU9 W8TRH5
gi|49486980|ref|YP_044201.1| gi|269203824|ref|YP_003283093.1| gi|387151314|ref|YP_005742878.1| gi|384870742|ref|YP_005753456.1| gi|151222307|ref|YP_001333129.1| gi|384862840|ref|YP_005745560.1| gi|156980506|ref|YP_001442765.1| gi|49484411|ref|YP_041635.1| gi|379015319|ref|YP_005291555.1| gi|384548408|ref|YP_005737661.1| gi|384866886|ref|YP_005747082.1| gi|379021864|ref|YP_005298526.1| gi|57650778|ref|YP_186993.1| gi|479330194|ref|YP_007869253.1| gi|387143902|ref|YP_005732296.1| gi|15925181|ref|NP_372715.1| gi|545638412|ref|YP_008588588.1| gi|15927771|ref|NP_375304.1| gi|21283846|ref|NP_646934.1| gi|537443408|ref|YP_008485985.1| gi|150394701|ref|YP_001317376.1| gi|514067156|ref|YP_008129076.1| gi|554645089|ref|YP_008716880.1| gi|384865372|ref|YP_005750731.1| gi|161510398|ref|YP_001576057.1| gi|521212956|ref|YP_008169302.1| gi|532360252|ref|YP_008450081.1| gi|385782429|ref|YP_005758600.1| gi|87160194|ref|YP_494787.1| gi|387781163|ref|YP_005755961.1| gi|386831769|ref|YP_006238423.1| gi|148268636|ref|YP_001247579.1| gi|545635554|ref|YP_008586124.1| gi|537461907|ref|YP_008492347.1| gi|82751789|ref|YP_417530.1| 158878.SAV2191 158879.SA1993 196620.MW2117 273036.SAB2072c 282458.SAR2282 282459.SAS2092 359786.SaurJH9_2222 359787.SaurJH1_2261 418127.SAHV_2175 426430.NWMN_2095 451515.SAUSA300_2151 451516.USA300HOU_2184 681288.SAAV_2252 93061.SAOUHSC_02451 93062.SACOL2182 gi|88196103|ref|YP_500918.1| gi|384550982|ref|YP_005740234.1| WP_001078309.1.100013 WP_001078309.1.100041 WP_001078309.1.100049 WP_001078309.1.100057 WP_001078309.1.10006 WP_001078309.1.100067 WP_001078309.1.100072 WP_001078309.1.100075 WP_001078309.1.100084 WP_001078309.1.100088 WP_001078309.1.100090 WP_001078309.1.100094 WP_001078309.1.100096 WP_001078309.1.100117 WP_001078309.1.100122 WP_001078309.1.10014 WP_001078309.1.100154 WP_001078309.1.100171 WP_001078309.1.100180 WP_001078309.1.100184 WP_001078309.1.100189 WP_001078309.1.100298 WP_001078309.1.100307 WP_001078309.1.100310 WP_001078309.1.10032 WP_001078309.1.100335 WP_001078309.1.100352 WP_001078309.1.100357 WP_001078309.1.100366 WP_001078309.1.100384 WP_001078309.1.100391 WP_001078309.1.100399 WP_001078309.1.10041 WP_001078309.1.10046 WP_001078309.1.100464 WP_001078309.1.10050 WP_001078309.1.100507 WP_001078309.1.100527 WP_001078309.1.100535 WP_001078309.1.100551 WP_001078309.1.100560 WP_001078309.1.100562 WP_001078309.1.100582 WP_001078309.1.100596 WP_001078309.1.100604 WP_001078309.1.100612 WP_001078309.1.100613 WP_001078309.1.100618 WP_001078309.1.100631 WP_001078309.1.100647 WP_001078309.1.100668 WP_001078309.1.100693 WP_001078309.1.100699 WP_001078309.1.100704 WP_001078309.1.100719 WP_001078309.1.100761 WP_001078309.1.100768 WP_001078309.1.100785 WP_001078309.1.100823 WP_001078309.1.100832 WP_001078309.1.100834 WP_001078309.1.10085 WP_001078309.1.100860 WP_001078309.1.100888 WP_001078309.1.1009 WP_001078309.1.100903 WP_001078309.1.100920 WP_001078309.1.100922 WP_001078309.1.100934 WP_001078309.1.100956 WP_001078309.1.100963 WP_001078309.1.10097 WP_001078309.1.100981 WP_001078309.1.100986 WP_001078309.1.100987 WP_001078309.1.101002 WP_001078309.1.101017 WP_001078309.1.101019 WP_001078309.1.101023 WP_001078309.1.101027 WP_001078309.1.101058 WP_001078309.1.101068 WP_001078309.1.101071 WP_001078309.1.101072 WP_001078309.1.101084 WP_001078309.1.101103 WP_001078309.1.10111 WP_001078309.1.101160 WP_001078309.1.101177 WP_001078309.1.101192 WP_001078309.1.101240 WP_001078309.1.101262 WP_001078309.1.101266 WP_001078309.1.101298 WP_001078309.1.101327 WP_001078309.1.101330 WP_001078309.1.101355 WP_001078309.1.101375 WP_001078309.1.101379 WP_001078309.1.101393 WP_001078309.1.101397 WP_001078309.1.101402 WP_001078309.1.101406 WP_001078309.1.101414 WP_001078309.1.101440 WP_001078309.1.101441 WP_001078309.1.101458 WP_001078309.1.10148 WP_001078309.1.101490 WP_001078309.1.1015 WP_001078309.1.101505 WP_001078309.1.101511 WP_001078309.1.101566 WP_001078309.1.101567 WP_001078309.1.101570 WP_001078309.1.101598 WP_001078309.1.101615 WP_001078309.1.101617 WP_001078309.1.101619 WP_001078309.1.101627 WP_001078309.1.101645 WP_001078309.1.10165 WP_001078309.1.101657 WP_001078309.1.10166 WP_001078309.1.101661 WP_001078309.1.101691 WP_001078309.1.101704 WP_001078309.1.101716 WP_001078309.1.101725 WP_001078309.1.101728 WP_001078309.1.101731 WP_001078309.1.101745 WP_001078309.1.101757 WP_001078309.1.101758 WP_001078309.1.101775 WP_001078309.1.101778 WP_001078309.1.101779 WP_001078309.1.101788 WP_001078309.1.101813 WP_001078309.1.101820 WP_001078309.1.101824 WP_001078309.1.101825 WP_001078309.1.101831 WP_001078309.1.101852 WP_001078309.1.101902 WP_001078309.1.101906 WP_001078309.1.101921 WP_001078309.1.101922 WP_001078309.1.101943 WP_001078309.1.101950 WP_001078309.1.102064 WP_001078309.1.102065 WP_001078309.1.102066 WP_001078309.1.102070 WP_001078309.1.102096 WP_001078309.1.102123 WP_001078309.1.102130 WP_001078309.1.102132 WP_001078309.1.10214 WP_001078309.1.1022 WP_001078309.1.10232 WP_001078309.1.10238 WP_001078309.1.10240 WP_001078309.1.10244 WP_001078309.1.10249 WP_001078309.1.1025 WP_001078309.1.10274 WP_001078309.1.10292 WP_001078309.1.10294 WP_001078309.1.10301 WP_001078309.1.10306 WP_001078309.1.1031 WP_001078309.1.1032 WP_001078309.1.10321 WP_001078309.1.10343 WP_001078309.1.10355 WP_001078309.1.10397 WP_001078309.1.10408 WP_001078309.1.1043 WP_001078309.1.10431 WP_001078309.1.10436 WP_001078309.1.10450 WP_001078309.1.10478 WP_001078309.1.10481 WP_001078309.1.10486 WP_001078309.1.10503 WP_001078309.1.1052 WP_001078309.1.10526 WP_001078309.1.10542 WP_001078309.1.10543 WP_001078309.1.10565 WP_001078309.1.10614 WP_001078309.1.10624 WP_001078309.1.10644 WP_001078309.1.10664 WP_001078309.1.10679 WP_001078309.1.10707 WP_001078309.1.10726 WP_001078309.1.10742 WP_001078309.1.10751 WP_001078309.1.1077 WP_001078309.1.10783 WP_001078309.1.10823 WP_001078309.1.10841 WP_001078309.1.10858 WP_001078309.1.1087 WP_001078309.1.10917 WP_001078309.1.10919 WP_001078309.1.10928 WP_001078309.1.10942 WP_001078309.1.10950 WP_001078309.1.10965 WP_001078309.1.10969 WP_001078309.1.1097 WP_001078309.1.10976 WP_001078309.1.10979 WP_001078309.1.10985 WP_001078309.1.10986 WP_001078309.1.11001 WP_001078309.1.11067 WP_001078309.1.11069 WP_001078309.1.11073 WP_001078309.1.11074 WP_001078309.1.11076 WP_001078309.1.11083 WP_001078309.1.11084 WP_001078309.1.11129 WP_001078309.1.1115 WP_001078309.1.11162 WP_001078309.1.11184 WP_001078309.1.1120 WP_001078309.1.11202 WP_001078309.1.11220 WP_001078309.1.11228 WP_001078309.1.11234 WP_001078309.1.11261 WP_001078309.1.11282 WP_001078309.1.11286 WP_001078309.1.11287 WP_001078309.1.11294 WP_001078309.1.11312 WP_001078309.1.11322 WP_001078309.1.11333 WP_001078309.1.11348 WP_001078309.1.11353 WP_001078309.1.1136 WP_001078309.1.11365 WP_001078309.1.11377 WP_001078309.1.11378 WP_001078309.1.11391 WP_001078309.1.11403 WP_001078309.1.11407 WP_001078309.1.11434 WP_001078309.1.11441 WP_001078309.1.11447 WP_001078309.1.11451 WP_001078309.1.11463 WP_001078309.1.1147 WP_001078309.1.11488 WP_001078309.1.11492 WP_001078309.1.11494 WP_001078309.1.11504 WP_001078309.1.1151 WP_001078309.1.11513 WP_001078309.1.1152 WP_001078309.1.11525 WP_001078309.1.11540 WP_001078309.1.11556 WP_001078309.1.11558 WP_001078309.1.11571 WP_001078309.1.11580 WP_001078309.1.11592 WP_001078309.1.11611 WP_001078309.1.11625 WP_001078309.1.11640 WP_001078309.1.11646 WP_001078309.1.11655 WP_001078309.1.11663 WP_001078309.1.11665 WP_001078309.1.11692 WP_001078309.1.117 WP_001078309.1.1171 WP_001078309.1.11719 WP_001078309.1.11720 WP_001078309.1.11723 WP_001078309.1.11730 WP_001078309.1.11768 WP_001078309.1.11794 WP_001078309.1.11795 WP_001078309.1.11828 WP_001078309.1.11829 WP_001078309.1.11837 WP_001078309.1.11884 WP_001078309.1.11894 WP_001078309.1.11903 WP_001078309.1.11904 WP_001078309.1.11969 WP_001078309.1.11991 WP_001078309.1.12005 WP_001078309.1.12019 WP_001078309.1.12026 WP_001078309.1.12029 WP_001078309.1.12042 WP_001078309.1.1205 WP_001078309.1.12073 WP_001078309.1.12098 WP_001078309.1.1210 WP_001078309.1.12123 WP_001078309.1.1213 WP_001078309.1.12149 WP_001078309.1.12152 WP_001078309.1.12158 WP_001078309.1.12170 WP_001078309.1.12175 WP_001078309.1.12179 WP_001078309.1.12181 WP_001078309.1.12193 WP_001078309.1.12194 WP_001078309.1.12201 WP_001078309.1.12226 WP_001078309.1.12233 WP_001078309.1.12234 WP_001078309.1.12256 WP_001078309.1.12272 WP_001078309.1.12297 WP_001078309.1.12328 WP_001078309.1.12330 WP_001078309.1.12366 WP_001078309.1.12391 WP_001078309.1.12436 WP_001078309.1.12437 WP_001078309.1.12447 WP_001078309.1.12498 WP_001078309.1.12508 WP_001078309.1.12516 WP_001078309.1.1252 WP_001078309.1.1253 WP_001078309.1.12555 WP_001078309.1.1257 WP_001078309.1.12597 WP_001078309.1.12598 WP_001078309.1.12608 WP_001078309.1.12618 WP_001078309.1.12639 WP_001078309.1.12668 WP_001078309.1.12685 WP_001078309.1.12711 WP_001078309.1.12715 WP_001078309.1.12733 WP_001078309.1.12737 WP_001078309.1.1276 WP_001078309.1.12770 WP_001078309.1.12771 WP_001078309.1.12772 WP_001078309.1.12780 WP_001078309.1.12788 WP_001078309.1.12822 WP_001078309.1.12829 WP_001078309.1.12833 WP_001078309.1.12845 WP_001078309.1.12858 WP_001078309.1.12862 WP_001078309.1.12884 WP_001078309.1.12886 WP_001078309.1.12903 WP_001078309.1.12904 WP_001078309.1.12918 WP_001078309.1.12920 WP_001078309.1.12937 WP_001078309.1.12938 WP_001078309.1.12977 WP_001078309.1.13013 WP_001078309.1.13039 WP_001078309.1.13062 WP_001078309.1.13072 WP_001078309.1.13091 WP_001078309.1.13104 WP_001078309.1.13154 WP_001078309.1.13164 WP_001078309.1.13169 WP_001078309.1.13228 WP_001078309.1.13243 WP_001078309.1.13250 WP_001078309.1.13303 WP_001078309.1.13307 WP_001078309.1.13317 WP_001078309.1.13322 WP_001078309.1.13326 WP_001078309.1.13336 WP_001078309.1.13355 WP_001078309.1.13379 WP_001078309.1.13381 WP_001078309.1.13405 WP_001078309.1.13448 WP_001078309.1.13468 WP_001078309.1.1347 WP_001078309.1.13486 WP_001078309.1.13501 WP_001078309.1.13505 WP_001078309.1.13514 WP_001078309.1.13531 WP_001078309.1.13532 WP_001078309.1.1355 WP_001078309.1.13554 WP_001078309.1.13556 WP_001078309.1.13557 WP_001078309.1.13568 WP_001078309.1.13598 WP_001078309.1.13612 WP_001078309.1.13617 WP_001078309.1.13650 WP_001078309.1.13654 WP_001078309.1.13665 WP_001078309.1.13668 WP_001078309.1.13670 WP_001078309.1.13679 WP_001078309.1.13680 WP_001078309.1.13683 WP_001078309.1.13696 WP_001078309.1.13709 WP_001078309.1.13726 WP_001078309.1.13727 WP_001078309.1.13733 WP_001078309.1.13734 WP_001078309.1.1374 WP_001078309.1.1375 WP_001078309.1.13755 WP_001078309.1.13757 WP_001078309.1.13772 WP_001078309.1.13787 WP_001078309.1.13804 WP_001078309.1.13805 WP_001078309.1.13807 WP_001078309.1.13831 WP_001078309.1.13879 WP_001078309.1.13897 WP_001078309.1.13904 WP_001078309.1.13914 WP_001078309.1.13933 WP_001078309.1.13940 WP_001078309.1.13947 WP_001078309.1.13983 WP_001078309.1.13986 WP_001078309.1.13987 WP_001078309.1.14010 WP_001078309.1.14025 WP_001078309.1.14034 WP_001078309.1.14071 WP_001078309.1.14076 WP_001078309.1.14097 WP_001078309.1.14112 WP_001078309.1.14143 WP_001078309.1.14153 WP_001078309.1.14163 WP_001078309.1.14192 WP_001078309.1.1420 WP_001078309.1.14201 WP_001078309.1.14221 WP_001078309.1.14233 WP_001078309.1.1425 WP_001078309.1.1426 WP_001078309.1.14272 WP_001078309.1.14281 WP_001078309.1.1429 WP_001078309.1.14302 WP_001078309.1.14305 WP_001078309.1.14314 WP_001078309.1.14342 WP_001078309.1.14355 WP_001078309.1.14358 WP_001078309.1.14364 WP_001078309.1.14365 WP_001078309.1.14366 WP_001078309.1.14372 WP_001078309.1.14394 WP_001078309.1.14397 WP_001078309.1.14412 WP_001078309.1.14418 WP_001078309.1.14475 WP_001078309.1.14535 WP_001078309.1.1457 WP_001078309.1.14577 WP_001078309.1.14590 WP_001078309.1.14596 WP_001078309.1.14639 WP_001078309.1.14666 WP_001078309.1.1468 WP_001078309.1.14696 WP_001078309.1.147 WP_001078309.1.1471 WP_001078309.1.14729 WP_001078309.1.14734 WP_001078309.1.14744 WP_001078309.1.1477 WP_001078309.1.14774 WP_001078309.1.14782 WP_001078309.1.14787 WP_001078309.1.14790 WP_001078309.1.14809 WP_001078309.1.14823 WP_001078309.1.14825 WP_001078309.1.14846 WP_001078309.1.14866 WP_001078309.1.14868 WP_001078309.1.14869 WP_001078309.1.14874 WP_001078309.1.14888 WP_001078309.1.1490 WP_001078309.1.14902 WP_001078309.1.14924 WP_001078309.1.14967 WP_001078309.1.14970 WP_001078309.1.14987 WP_001078309.1.15000 WP_001078309.1.15015 WP_001078309.1.15022 WP_001078309.1.15029 WP_001078309.1.15039 WP_001078309.1.15091 WP_001078309.1.15108 WP_001078309.1.15173 WP_001078309.1.15182 WP_001078309.1.15185 WP_001078309.1.1520 WP_001078309.1.15201 WP_001078309.1.15228 WP_001078309.1.15234 WP_001078309.1.15241 WP_001078309.1.1525 WP_001078309.1.15255 WP_001078309.1.15263 WP_001078309.1.15268 WP_001078309.1.15269 WP_001078309.1.15278 WP_001078309.1.15294 WP_001078309.1.15296 WP_001078309.1.15329 WP_001078309.1.15389 WP_001078309.1.15399 WP_001078309.1.15403 WP_001078309.1.15409 WP_001078309.1.15421 WP_001078309.1.15438 WP_001078309.1.1545 WP_001078309.1.15478 WP_001078309.1.15489 WP_001078309.1.15505 WP_001078309.1.15507 WP_001078309.1.15519 WP_001078309.1.15524 WP_001078309.1.15533 WP_001078309.1.15544 WP_001078309.1.15546 WP_001078309.1.15554 WP_001078309.1.15572 WP_001078309.1.1558 WP_001078309.1.15590 WP_001078309.1.15601 WP_001078309.1.1562 WP_001078309.1.1564 WP_001078309.1.15641 WP_001078309.1.15687 WP_001078309.1.1569 WP_001078309.1.15691 WP_001078309.1.15706 WP_001078309.1.15712 WP_001078309.1.15722 WP_001078309.1.15753 WP_001078309.1.15785 WP_001078309.1.1579 WP_001078309.1.15812 WP_001078309.1.15818 WP_001078309.1.1583 WP_001078309.1.15838 WP_001078309.1.15883 WP_001078309.1.15892 WP_001078309.1.15897 WP_001078309.1.15898 WP_001078309.1.159 WP_001078309.1.15920 WP_001078309.1.15921 WP_001078309.1.15925 WP_001078309.1.15928 WP_001078309.1.15939 WP_001078309.1.15957 WP_001078309.1.15972 WP_001078309.1.1599 WP_001078309.1.1600 WP_001078309.1.16018 WP_001078309.1.16026 WP_001078309.1.1606 WP_001078309.1.16068 WP_001078309.1.16083 WP_001078309.1.16095 WP_001078309.1.16096 WP_001078309.1.16098 WP_001078309.1.16112 WP_001078309.1.16114 WP_001078309.1.16140 WP_001078309.1.16173 WP_001078309.1.16195 WP_001078309.1.16203 WP_001078309.1.16213 WP_001078309.1.16214 WP_001078309.1.16223 WP_001078309.1.1623 WP_001078309.1.16237 WP_001078309.1.16251 WP_001078309.1.16265 WP_001078309.1.16276 WP_001078309.1.16283 WP_001078309.1.16311 WP_001078309.1.16362 WP_001078309.1.16372 WP_001078309.1.16395 WP_001078309.1.16407 WP_001078309.1.16408 WP_001078309.1.16414 WP_001078309.1.16417 WP_001078309.1.16433 WP_001078309.1.16458 WP_001078309.1.16554 WP_001078309.1.16564 WP_001078309.1.16569 WP_001078309.1.16589 WP_001078309.1.16603 WP_001078309.1.16606 WP_001078309.1.16617 WP_001078309.1.1662 WP_001078309.1.16628 WP_001078309.1.16632 WP_001078309.1.16639 WP_001078309.1.16649 WP_001078309.1.1665 WP_001078309.1.16651 WP_001078309.1.16653 WP_001078309.1.1666 WP_001078309.1.16664 WP_001078309.1.16672 WP_001078309.1.16679 WP_001078309.1.16684 WP_001078309.1.16688 WP_001078309.1.16693 WP_001078309.1.16703 WP_001078309.1.16747 WP_001078309.1.16757 WP_001078309.1.16761 WP_001078309.1.16762 WP_001078309.1.16768 WP_001078309.1.16770 WP_001078309.1.16776 WP_001078309.1.16794 WP_001078309.1.16802 WP_001078309.1.16815 WP_001078309.1.16824 WP_001078309.1.16833 WP_001078309.1.16880 WP_001078309.1.16882 WP_001078309.1.16892 WP_001078309.1.16920 WP_001078309.1.16925 WP_001078309.1.16936 WP_001078309.1.16938 WP_001078309.1.16946 WP_001078309.1.16969 WP_001078309.1.16986 WP_001078309.1.170 WP_001078309.1.17012 WP_001078309.1.17038 WP_001078309.1.17046 WP_001078309.1.17050 WP_001078309.1.17080 WP_001078309.1.17104 WP_001078309.1.17122 WP_001078309.1.17132 WP_001078309.1.17137 WP_001078309.1.17139 WP_001078309.1.17156 WP_001078309.1.17157 WP_001078309.1.17169 WP_001078309.1.17180 WP_001078309.1.17193 WP_001078309.1.17200 WP_001078309.1.17210 WP_001078309.1.17231 WP_001078309.1.17234 WP_001078309.1.17240 WP_001078309.1.17248 WP_001078309.1.17249 WP_001078309.1.1725 WP_001078309.1.17256 WP_001078309.1.1729 WP_001078309.1.17296 WP_001078309.1.17309 WP_001078309.1.17320 WP_001078309.1.17327 WP_001078309.1.1736 WP_001078309.1.1740 WP_001078309.1.1741 WP_001078309.1.17419 WP_001078309.1.17450 WP_001078309.1.17454 WP_001078309.1.17456 WP_001078309.1.17475 WP_001078309.1.17485 WP_001078309.1.1751 WP_001078309.1.17520 WP_001078309.1.17524 WP_001078309.1.17526 WP_001078309.1.17529 WP_001078309.1.17531 WP_001078309.1.1756 WP_001078309.1.17581 WP_001078309.1.17590 WP_001078309.1.17628 WP_001078309.1.17643 WP_001078309.1.1765 WP_001078309.1.17650 WP_001078309.1.17651 WP_001078309.1.17657 WP_001078309.1.17658 WP_001078309.1.17666 WP_001078309.1.17671 WP_001078309.1.17676 WP_001078309.1.1771 WP_001078309.1.17717 WP_001078309.1.17718 WP_001078309.1.17720 WP_001078309.1.17725 WP_001078309.1.17729 WP_001078309.1.17737 WP_001078309.1.17770 WP_001078309.1.17796 WP_001078309.1.17818 WP_001078309.1.17832 WP_001078309.1.17834 WP_001078309.1.17835 WP_001078309.1.17838 WP_001078309.1.17845 WP_001078309.1.17847 WP_001078309.1.17853 WP_001078309.1.17859 WP_001078309.1.1787 WP_001078309.1.17876 WP_001078309.1.17882 WP_001078309.1.17909 WP_001078309.1.17922 WP_001078309.1.17929 WP_001078309.1.17943 WP_001078309.1.17951 WP_001078309.1.17966 WP_001078309.1.18016 WP_001078309.1.18035 WP_001078309.1.18069 WP_001078309.1.18074 WP_001078309.1.18080 WP_001078309.1.18105 WP_001078309.1.1811 WP_001078309.1.18113 WP_001078309.1.18132 WP_001078309.1.18140 WP_001078309.1.18153 WP_001078309.1.18197 WP_001078309.1.18203 WP_001078309.1.18205 WP_001078309.1.18237 WP_001078309.1.18248 WP_001078309.1.18261 WP_001078309.1.18273 WP_001078309.1.18283 WP_001078309.1.18288 WP_001078309.1.1829 WP_001078309.1.18290 WP_001078309.1.18301 WP_001078309.1.18309 WP_001078309.1.18310 WP_001078309.1.18320 WP_001078309.1.18346 WP_001078309.1.1835 WP_001078309.1.18360 WP_001078309.1.18412 WP_001078309.1.18424 WP_001078309.1.18429 WP_001078309.1.18437 WP_001078309.1.18451 WP_001078309.1.18466 WP_001078309.1.1847 WP_001078309.1.18487 WP_001078309.1.1849 WP_001078309.1.18497 WP_001078309.1.185 WP_001078309.1.18504 WP_001078309.1.18506 WP_001078309.1.18507 WP_001078309.1.1851 WP_001078309.1.18516 WP_001078309.1.18526 WP_001078309.1.18527 WP_001078309.1.18529 WP_001078309.1.18538 WP_001078309.1.18539 WP_001078309.1.18545 WP_001078309.1.18560 WP_001078309.1.18562 WP_001078309.1.18566 WP_001078309.1.18567 WP_001078309.1.18570 WP_001078309.1.18590 WP_001078309.1.18591 WP_001078309.1.18605 WP_001078309.1.18611 WP_001078309.1.18627 WP_001078309.1.18632 WP_001078309.1.18658 WP_001078309.1.18668 WP_001078309.1.18679 WP_001078309.1.18741 WP_001078309.1.18758 WP_001078309.1.18763 WP_001078309.1.18774 WP_001078309.1.18777 WP_001078309.1.18779 WP_001078309.1.18792 WP_001078309.1.18799 WP_001078309.1.18809 WP_001078309.1.18818 WP_001078309.1.18819 WP_001078309.1.18830 WP_001078309.1.18834 WP_001078309.1.18836 WP_001078309.1.18870 WP_001078309.1.18879 WP_001078309.1.18882 WP_001078309.1.18918 WP_001078309.1.1892 WP_001078309.1.18938 WP_001078309.1.18965 WP_001078309.1.18974 WP_001078309.1.18987 WP_001078309.1.18996 WP_001078309.1.19009 WP_001078309.1.1901 WP_001078309.1.19022 WP_001078309.1.19027 WP_001078309.1.19052 WP_001078309.1.19082 WP_001078309.1.1911 WP_001078309.1.1912 WP_001078309.1.19149 WP_001078309.1.19179 WP_001078309.1.192 WP_001078309.1.19259 WP_001078309.1.19272 WP_001078309.1.19301 WP_001078309.1.19322 WP_001078309.1.19365 WP_001078309.1.19370 WP_001078309.1.19386 WP_001078309.1.19390 WP_001078309.1.19399 WP_001078309.1.1940 WP_001078309.1.19411 WP_001078309.1.19430 WP_001078309.1.19444 WP_001078309.1.19450 WP_001078309.1.19455 WP_001078309.1.19497 WP_001078309.1.19509 WP_001078309.1.19515 WP_001078309.1.19537 WP_001078309.1.19555 WP_001078309.1.19575 WP_001078309.1.19577 WP_001078309.1.19611 WP_001078309.1.1964 WP_001078309.1.19643 WP_001078309.1.19653 WP_001078309.1.19717 WP_001078309.1.19725 WP_001078309.1.19732 WP_001078309.1.19733 WP_001078309.1.1974 WP_001078309.1.19748 WP_001078309.1.1975 WP_001078309.1.19765 WP_001078309.1.19775 WP_001078309.1.19792 WP_001078309.1.19801 WP_001078309.1.19807 WP_001078309.1.19816 WP_001078309.1.19848 WP_001078309.1.19853 WP_001078309.1.19891 WP_001078309.1.19904 WP_001078309.1.19905 WP_001078309.1.19912 WP_001078309.1.19921 WP_001078309.1.19928 WP_001078309.1.19968 WP_001078309.1.19977 WP_001078309.1.19980 WP_001078309.1.19981 WP_001078309.1.2 WP_001078309.1.20006 WP_001078309.1.20049 WP_001078309.1.20052 WP_001078309.1.20057 WP_001078309.1.2007 WP_001078309.1.20078 WP_001078309.1.2008 WP_001078309.1.20090 WP_001078309.1.20100 WP_001078309.1.20101 WP_001078309.1.2013 WP_001078309.1.20155 WP_001078309.1.20156 WP_001078309.1.20160 WP_001078309.1.20161 WP_001078309.1.20167 WP_001078309.1.20177 WP_001078309.1.20191 WP_001078309.1.20201 WP_001078309.1.20210 WP_001078309.1.20214 WP_001078309.1.20219 WP_001078309.1.20221 WP_001078309.1.20235 WP_001078309.1.20245 WP_001078309.1.2025 WP_001078309.1.20265 WP_001078309.1.2029 WP_001078309.1.20307 WP_001078309.1.20324 WP_001078309.1.20340 WP_001078309.1.20354 WP_001078309.1.20358 WP_001078309.1.20386 WP_001078309.1.20394 WP_001078309.1.20398 WP_001078309.1.20399 WP_001078309.1.20411 WP_001078309.1.20473 WP_001078309.1.20479 WP_001078309.1.20487 WP_001078309.1.20496 WP_001078309.1.20500 WP_001078309.1.20512 WP_001078309.1.20550 WP_001078309.1.20554 WP_001078309.1.2056 WP_001078309.1.20574 WP_001078309.1.20579 WP_001078309.1.20585 WP_001078309.1.20598 WP_001078309.1.20611 WP_001078309.1.20618 WP_001078309.1.20619 WP_001078309.1.20620 WP_001078309.1.20661 WP_001078309.1.20690 WP_001078309.1.20698 WP_001078309.1.20736 WP_001078309.1.20772 WP_001078309.1.2079 WP_001078309.1.20796 WP_001078309.1.20821 WP_001078309.1.20833 WP_001078309.1.20838 WP_001078309.1.20846 WP_001078309.1.20860 WP_001078309.1.20866 WP_001078309.1.20867 WP_001078309.1.20878 WP_001078309.1.20906 WP_001078309.1.20913 WP_001078309.1.20922 WP_001078309.1.20935 WP_001078309.1.20939 WP_001078309.1.20945 WP_001078309.1.20971 WP_001078309.1.20975 WP_001078309.1.21009 WP_001078309.1.21013 WP_001078309.1.21015 WP_001078309.1.21031 WP_001078309.1.21036 WP_001078309.1.21054 WP_001078309.1.21056 WP_001078309.1.21066 WP_001078309.1.21078 WP_001078309.1.21080 WP_001078309.1.21081 WP_001078309.1.21109 WP_001078309.1.21111 WP_001078309.1.21140 WP_001078309.1.21154 WP_001078309.1.21183 WP_001078309.1.2119 WP_001078309.1.21222 WP_001078309.1.21257 WP_001078309.1.21259 WP_001078309.1.21272 WP_001078309.1.2128 WP_001078309.1.2129 WP_001078309.1.21312 WP_001078309.1.21313 WP_001078309.1.21314 WP_001078309.1.21330 WP_001078309.1.21339 WP_001078309.1.2135 WP_001078309.1.21356 WP_001078309.1.21359 WP_001078309.1.21375 WP_001078309.1.21379 WP_001078309.1.21386 WP_001078309.1.21393 WP_001078309.1.21402 WP_001078309.1.21412 WP_001078309.1.21416 WP_001078309.1.21449 WP_001078309.1.21458 WP_001078309.1.21464 WP_001078309.1.21465 WP_001078309.1.21477 WP_001078309.1.21480 WP_001078309.1.21500 WP_001078309.1.21505 WP_001078309.1.21511 WP_001078309.1.21514 WP_001078309.1.2154 WP_001078309.1.21572 WP_001078309.1.21583 WP_001078309.1.21589 WP_001078309.1.2159 WP_001078309.1.2160 WP_001078309.1.21601 WP_001078309.1.21636 WP_001078309.1.21679 WP_001078309.1.21712 WP_001078309.1.21719 WP_001078309.1.21724 WP_001078309.1.21746 WP_001078309.1.21763 WP_001078309.1.2178 WP_001078309.1.21787 WP_001078309.1.21820 WP_001078309.1.21828 WP_001078309.1.21830 WP_001078309.1.21890 WP_001078309.1.21900 WP_001078309.1.21901 WP_001078309.1.21919 WP_001078309.1.21985 WP_001078309.1.21988 WP_001078309.1.2200 WP_001078309.1.22000 WP_001078309.1.22011 WP_001078309.1.22027 WP_001078309.1.22033 WP_001078309.1.22038 WP_001078309.1.22045 WP_001078309.1.22049 WP_001078309.1.22065 WP_001078309.1.22082 WP_001078309.1.22111 WP_001078309.1.22149 WP_001078309.1.22163 WP_001078309.1.22164 WP_001078309.1.22165 WP_001078309.1.22170 WP_001078309.1.22174 WP_001078309.1.22177 WP_001078309.1.22180 WP_001078309.1.22197 WP_001078309.1.22227 WP_001078309.1.22246 WP_001078309.1.22302 WP_001078309.1.22307 WP_001078309.1.22332 WP_001078309.1.22344 WP_001078309.1.22351 WP_001078309.1.22367 WP_001078309.1.22369 WP_001078309.1.22400 WP_001078309.1.22419 WP_001078309.1.22426 WP_001078309.1.22441 WP_001078309.1.22493 WP_001078309.1.22498 WP_001078309.1.22512 WP_001078309.1.22526 WP_001078309.1.22531 WP_001078309.1.22533 WP_001078309.1.22547 WP_001078309.1.22551 WP_001078309.1.22559 WP_001078309.1.22650 WP_001078309.1.22657 WP_001078309.1.22684 WP_001078309.1.22696 WP_001078309.1.22702 WP_001078309.1.22709 WP_001078309.1.22714 WP_001078309.1.22730 WP_001078309.1.22731 WP_001078309.1.22738 WP_001078309.1.22764 WP_001078309.1.22787 WP_001078309.1.22789 WP_001078309.1.22790 WP_001078309.1.22792 WP_001078309.1.2280 WP_001078309.1.22803 WP_001078309.1.22808 WP_001078309.1.22811 WP_001078309.1.22826 WP_001078309.1.22843 WP_001078309.1.22853 WP_001078309.1.22859 WP_001078309.1.22861 WP_001078309.1.22869 WP_001078309.1.22890 WP_001078309.1.22924 WP_001078309.1.22969 WP_001078309.1.22983 WP_001078309.1.22984 WP_001078309.1.22994 WP_001078309.1.23004 WP_001078309.1.23008 WP_001078309.1.23012 WP_001078309.1.23048 WP_001078309.1.23061 WP_001078309.1.23082 WP_001078309.1.23103 WP_001078309.1.23121 WP_001078309.1.23130 WP_001078309.1.23132 WP_001078309.1.23133 WP_001078309.1.23146 WP_001078309.1.23152 WP_001078309.1.23161 WP_001078309.1.23185 WP_001078309.1.23194 WP_001078309.1.23197 WP_001078309.1.23222 WP_001078309.1.23228 WP_001078309.1.23238 WP_001078309.1.23244 WP_001078309.1.23251 WP_001078309.1.2327 WP_001078309.1.23275 WP_001078309.1.23288 WP_001078309.1.23304 WP_001078309.1.23381 WP_001078309.1.23413 WP_001078309.1.23420 WP_001078309.1.23431 WP_001078309.1.23439 WP_001078309.1.23449 WP_001078309.1.23450 WP_001078309.1.23476 WP_001078309.1.23489 WP_001078309.1.23491 WP_001078309.1.23517 WP_001078309.1.23531 WP_001078309.1.23541 WP_001078309.1.23544 WP_001078309.1.23557 WP_001078309.1.23572 WP_001078309.1.23586 WP_001078309.1.23613 WP_001078309.1.23617 WP_001078309.1.23626 WP_001078309.1.23630 WP_001078309.1.23644 WP_001078309.1.2365 WP_001078309.1.23671 WP_001078309.1.23690 WP_001078309.1.23708 WP_001078309.1.23710 WP_001078309.1.23730 WP_001078309.1.23740 WP_001078309.1.23809 WP_001078309.1.23822 WP_001078309.1.23842 WP_001078309.1.23849 WP_001078309.1.2389 WP_001078309.1.23900 WP_001078309.1.23907 WP_001078309.1.23926 WP_001078309.1.23935 WP_001078309.1.23944 WP_001078309.1.23956 WP_001078309.1.23995 WP_001078309.1.23998 WP_001078309.1.24000 WP_001078309.1.24081 WP_001078309.1.24129 WP_001078309.1.24148 WP_001078309.1.24154 WP_001078309.1.24167 WP_001078309.1.24174 WP_001078309.1.24207 WP_001078309.1.24213 WP_001078309.1.24226 WP_001078309.1.2423 WP_001078309.1.24241 WP_001078309.1.24263 WP_001078309.1.24276 WP_001078309.1.24277 WP_001078309.1.24279 WP_001078309.1.24286 WP_001078309.1.24302 WP_001078309.1.2434 WP_001078309.1.24343 WP_001078309.1.24347 WP_001078309.1.24364 WP_001078309.1.24365 WP_001078309.1.24388 WP_001078309.1.24416 WP_001078309.1.24418 WP_001078309.1.2442 WP_001078309.1.24437 WP_001078309.1.24443 WP_001078309.1.24462 WP_001078309.1.24469 WP_001078309.1.24478 WP_001078309.1.2450 WP_001078309.1.24502 WP_001078309.1.24503 WP_001078309.1.24516 WP_001078309.1.24519 WP_001078309.1.24569 WP_001078309.1.24572 WP_001078309.1.2458 WP_001078309.1.24589 WP_001078309.1.24596 WP_001078309.1.24597 WP_001078309.1.24602 WP_001078309.1.24617 WP_001078309.1.24625 WP_001078309.1.24631 WP_001078309.1.24644 WP_001078309.1.24654 WP_001078309.1.24674 WP_001078309.1.24679 WP_001078309.1.24681 WP_001078309.1.24684 WP_001078309.1.24685 WP_001078309.1.24702 WP_001078309.1.24711 WP_001078309.1.24714 WP_001078309.1.24745 WP_001078309.1.24780 WP_001078309.1.24781 WP_001078309.1.2480 WP_001078309.1.24802 WP_001078309.1.24817 WP_001078309.1.24823 WP_001078309.1.24834 WP_001078309.1.24855 WP_001078309.1.24856 WP_001078309.1.24891 WP_001078309.1.24903 WP_001078309.1.24918 WP_001078309.1.24937 WP_001078309.1.2497 WP_001078309.1.24996 WP_001078309.1.25001 WP_001078309.1.25007 WP_001078309.1.2501 WP_001078309.1.25012 WP_001078309.1.2506 WP_001078309.1.25070 WP_001078309.1.25083 WP_001078309.1.25092 WP_001078309.1.25098 WP_001078309.1.25115 WP_001078309.1.25117 WP_001078309.1.25120 WP_001078309.1.25145 WP_001078309.1.25167 WP_001078309.1.25170 WP_001078309.1.25187 WP_001078309.1.25209 WP_001078309.1.25216 WP_001078309.1.25221 WP_001078309.1.25262 WP_001078309.1.25287 WP_001078309.1.25288 WP_001078309.1.25331 WP_001078309.1.25341 WP_001078309.1.25345 WP_001078309.1.25361 WP_001078309.1.25433 WP_001078309.1.25438 WP_001078309.1.2544 WP_001078309.1.25459 WP_001078309.1.25469 WP_001078309.1.25479 WP_001078309.1.25488 WP_001078309.1.25489 WP_001078309.1.25495 WP_001078309.1.25511 WP_001078309.1.2552 WP_001078309.1.25557 WP_001078309.1.25567 WP_001078309.1.25569 WP_001078309.1.25591 WP_001078309.1.25593 WP_001078309.1.25595 WP_001078309.1.25597 WP_001078309.1.25621 WP_001078309.1.25623 WP_001078309.1.25634 WP_001078309.1.25651 WP_001078309.1.25721 WP_001078309.1.25732 WP_001078309.1.25737 WP_001078309.1.25744 WP_001078309.1.25758 WP_001078309.1.25770 WP_001078309.1.25772 WP_001078309.1.25779 WP_001078309.1.2579 WP_001078309.1.25801 WP_001078309.1.25802 WP_001078309.1.25820 WP_001078309.1.25840 WP_001078309.1.25856 WP_001078309.1.25857 WP_001078309.1.25867 WP_001078309.1.25868 WP_001078309.1.25881 WP_001078309.1.25891 WP_001078309.1.2590 WP_001078309.1.25910 WP_001078309.1.2592 WP_001078309.1.25924 WP_001078309.1.25929 WP_001078309.1.2593 WP_001078309.1.25930 WP_001078309.1.25955 WP_001078309.1.26006 WP_001078309.1.26012 WP_001078309.1.26015 WP_001078309.1.26039 WP_001078309.1.26050 WP_001078309.1.26058 WP_001078309.1.2608 WP_001078309.1.26086 WP_001078309.1.26094 WP_001078309.1.26106 WP_001078309.1.26143 WP_001078309.1.26169 WP_001078309.1.262 WP_001078309.1.2621 WP_001078309.1.26225 WP_001078309.1.26226 WP_001078309.1.26255 WP_001078309.1.26266 WP_001078309.1.26271 WP_001078309.1.26276 WP_001078309.1.26283 WP_001078309.1.26290 WP_001078309.1.26293 WP_001078309.1.26298 WP_001078309.1.26306 WP_001078309.1.26307 WP_001078309.1.26314 WP_001078309.1.26315 WP_001078309.1.26318 WP_001078309.1.2633 WP_001078309.1.26340 WP_001078309.1.26345 WP_001078309.1.26346 WP_001078309.1.26354 WP_001078309.1.26359 WP_001078309.1.26364 WP_001078309.1.26370 WP_001078309.1.26399 WP_001078309.1.26404 WP_001078309.1.26405 WP_001078309.1.26424 WP_001078309.1.2643 WP_001078309.1.26431 WP_001078309.1.26481 WP_001078309.1.26506 WP_001078309.1.26533 WP_001078309.1.26555 WP_001078309.1.2656 WP_001078309.1.2658 WP_001078309.1.2661 WP_001078309.1.26626 WP_001078309.1.2664 WP_001078309.1.26650 WP_001078309.1.26662 WP_001078309.1.26663 WP_001078309.1.26664 WP_001078309.1.26677 WP_001078309.1.26692 WP_001078309.1.26713 WP_001078309.1.26726 WP_001078309.1.2673 WP_001078309.1.26733 WP_001078309.1.26751 WP_001078309.1.26771 WP_001078309.1.26772 WP_001078309.1.26773 WP_001078309.1.26778 WP_001078309.1.26790 WP_001078309.1.2680 WP_001078309.1.26804 WP_001078309.1.2684 WP_001078309.1.26840 WP_001078309.1.26864 WP_001078309.1.26865 WP_001078309.1.26884 WP_001078309.1.26886 WP_001078309.1.2689 WP_001078309.1.26903 WP_001078309.1.26905 WP_001078309.1.26927 WP_001078309.1.26938 WP_001078309.1.26944 WP_001078309.1.26947 WP_001078309.1.26958 WP_001078309.1.27013 WP_001078309.1.27042 WP_001078309.1.27053 WP_001078309.1.27083 WP_001078309.1.27097 WP_001078309.1.2710 WP_001078309.1.27120 WP_001078309.1.27127 WP_001078309.1.27147 WP_001078309.1.27154 WP_001078309.1.27160 WP_001078309.1.27166 WP_001078309.1.27170 WP_001078309.1.2718 WP_001078309.1.27182 WP_001078309.1.2719 WP_001078309.1.27199 WP_001078309.1.27207 WP_001078309.1.27226 WP_001078309.1.27237 WP_001078309.1.27246 WP_001078309.1.2725 WP_001078309.1.27262 WP_001078309.1.27293 WP_001078309.1.27294 WP_001078309.1.27303 WP_001078309.1.27311 WP_001078309.1.27323 WP_001078309.1.27333 WP_001078309.1.2734 WP_001078309.1.27345 WP_001078309.1.27379 WP_001078309.1.27384 WP_001078309.1.27387 WP_001078309.1.27413 WP_001078309.1.27415 WP_001078309.1.2744 WP_001078309.1.27447 WP_001078309.1.27448 WP_001078309.1.27455 WP_001078309.1.27456 WP_001078309.1.27457 WP_001078309.1.27468 WP_001078309.1.27489 WP_001078309.1.27516 WP_001078309.1.27529 WP_001078309.1.2753 WP_001078309.1.27539 WP_001078309.1.27551 WP_001078309.1.27562 WP_001078309.1.2759 WP_001078309.1.27590 WP_001078309.1.27605 WP_001078309.1.27608 WP_001078309.1.27614 WP_001078309.1.27615 WP_001078309.1.27621 WP_001078309.1.27622 WP_001078309.1.27628 WP_001078309.1.27640 WP_001078309.1.27646 WP_001078309.1.27654 WP_001078309.1.27662 WP_001078309.1.27667 WP_001078309.1.27670 WP_001078309.1.27673 WP_001078309.1.2768 WP_001078309.1.27689 WP_001078309.1.27717 WP_001078309.1.27720 WP_001078309.1.27739 WP_001078309.1.27744 WP_001078309.1.27748 WP_001078309.1.27765 WP_001078309.1.27787 WP_001078309.1.27793 WP_001078309.1.27817 WP_001078309.1.27830 WP_001078309.1.27834 WP_001078309.1.27854 WP_001078309.1.2795 WP_001078309.1.27950 WP_001078309.1.27953 WP_001078309.1.27972 WP_001078309.1.27999 WP_001078309.1.2800 WP_001078309.1.28007 WP_001078309.1.28016 WP_001078309.1.28025 WP_001078309.1.28063 WP_001078309.1.28071 WP_001078309.1.28074 WP_001078309.1.2808 WP_001078309.1.28081 WP_001078309.1.28088 WP_001078309.1.28091 WP_001078309.1.28105 WP_001078309.1.28107 WP_001078309.1.28117 WP_001078309.1.28138 WP_001078309.1.28147 WP_001078309.1.28158 WP_001078309.1.28173 WP_001078309.1.28191 WP_001078309.1.28207 WP_001078309.1.28213 WP_001078309.1.28226 WP_001078309.1.28230 WP_001078309.1.28253 WP_001078309.1.28257 WP_001078309.1.28274 WP_001078309.1.28298 WP_001078309.1.28315 WP_001078309.1.28319 WP_001078309.1.28334 WP_001078309.1.28336 WP_001078309.1.28337 WP_001078309.1.28347 WP_001078309.1.28358 WP_001078309.1.28360 WP_001078309.1.28376 WP_001078309.1.28381 WP_001078309.1.28388 WP_001078309.1.28392 WP_001078309.1.28394 WP_001078309.1.2840 WP_001078309.1.28400 WP_001078309.1.28426 WP_001078309.1.28430 WP_001078309.1.28477 WP_001078309.1.28490 WP_001078309.1.28498 WP_001078309.1.28502 WP_001078309.1.2852 WP_001078309.1.28526 WP_001078309.1.28527 WP_001078309.1.28532 WP_001078309.1.28578 WP_001078309.1.28580 WP_001078309.1.28605 WP_001078309.1.28629 WP_001078309.1.28636 WP_001078309.1.28650 WP_001078309.1.28652 WP_001078309.1.28672 WP_001078309.1.28675 WP_001078309.1.28691 WP_001078309.1.28710 WP_001078309.1.28720 WP_001078309.1.28725 WP_001078309.1.28763 WP_001078309.1.28784 WP_001078309.1.28785 WP_001078309.1.28825 WP_001078309.1.28833 WP_001078309.1.28848 WP_001078309.1.28862 WP_001078309.1.28866 WP_001078309.1.28871 WP_001078309.1.28874 WP_001078309.1.28887 WP_001078309.1.28909 WP_001078309.1.28915 WP_001078309.1.28933 WP_001078309.1.28934 WP_001078309.1.28960 WP_001078309.1.28970 WP_001078309.1.28981 WP_001078309.1.28987 WP_001078309.1.29014 WP_001078309.1.29052 WP_001078309.1.2906 WP_001078309.1.29060 WP_001078309.1.29090 WP_001078309.1.29091 WP_001078309.1.29107 WP_001078309.1.29110 WP_001078309.1.29155 WP_001078309.1.29166 WP_001078309.1.29170 WP_001078309.1.29187 WP_001078309.1.29188 WP_001078309.1.29207 WP_001078309.1.29226 WP_001078309.1.29242 WP_001078309.1.29243 WP_001078309.1.29250 WP_001078309.1.29263 WP_001078309.1.29272 WP_001078309.1.29276 WP_001078309.1.29282 WP_001078309.1.29285 WP_001078309.1.29312 WP_001078309.1.29315 WP_001078309.1.29329 WP_001078309.1.29340 WP_001078309.1.29366 WP_001078309.1.29368 WP_001078309.1.29372 WP_001078309.1.29373 WP_001078309.1.29375 WP_001078309.1.29381 WP_001078309.1.29395 WP_001078309.1.29420 WP_001078309.1.29433 WP_001078309.1.29445 WP_001078309.1.29453 WP_001078309.1.29468 WP_001078309.1.29479 WP_001078309.1.29483 WP_001078309.1.29484 WP_001078309.1.29511 WP_001078309.1.29522 WP_001078309.1.29541 WP_001078309.1.29553 WP_001078309.1.29554 WP_001078309.1.29557 WP_001078309.1.29561 WP_001078309.1.2957 WP_001078309.1.29571 WP_001078309.1.29596 WP_001078309.1.29644 WP_001078309.1.29676 WP_001078309.1.29692 WP_001078309.1.29709 WP_001078309.1.29710 WP_001078309.1.29716 WP_001078309.1.2972 WP_001078309.1.29736 WP_001078309.1.29744 WP_001078309.1.2975 WP_001078309.1.29758 WP_001078309.1.29781 WP_001078309.1.29788 WP_001078309.1.29805 WP_001078309.1.2981 WP_001078309.1.29862 WP_001078309.1.29885 WP_001078309.1.29902 WP_001078309.1.29905 WP_001078309.1.29918 WP_001078309.1.29956 WP_001078309.1.29963 WP_001078309.1.29981 WP_001078309.1.30012 WP_001078309.1.30023 WP_001078309.1.30033 WP_001078309.1.30047 WP_001078309.1.30051 WP_001078309.1.30057 WP_001078309.1.30089 WP_001078309.1.30095 WP_001078309.1.30100 WP_001078309.1.30115 WP_001078309.1.3012 WP_001078309.1.30150 WP_001078309.1.30152 WP_001078309.1.30154 WP_001078309.1.30159 WP_001078309.1.30169 WP_001078309.1.30176 WP_001078309.1.30186 WP_001078309.1.30188 WP_001078309.1.30190 WP_001078309.1.30197 WP_001078309.1.30203 WP_001078309.1.30204 WP_001078309.1.30209 WP_001078309.1.30230 WP_001078309.1.30262 WP_001078309.1.30268 WP_001078309.1.30274 WP_001078309.1.3029 WP_001078309.1.30294 WP_001078309.1.30302 WP_001078309.1.30307 WP_001078309.1.30328 WP_001078309.1.30333 WP_001078309.1.30350 WP_001078309.1.30364 WP_001078309.1.30367 WP_001078309.1.30376 WP_001078309.1.30381 WP_001078309.1.30392 WP_001078309.1.30418 WP_001078309.1.30422 WP_001078309.1.30458 WP_001078309.1.30477 WP_001078309.1.30482 WP_001078309.1.30496 WP_001078309.1.3050 WP_001078309.1.30508 WP_001078309.1.30530 WP_001078309.1.30531 WP_001078309.1.30560 WP_001078309.1.30600 WP_001078309.1.30622 WP_001078309.1.30623 WP_001078309.1.30645 WP_001078309.1.30646 WP_001078309.1.30666 WP_001078309.1.30668 WP_001078309.1.30690 WP_001078309.1.30702 WP_001078309.1.30720 WP_001078309.1.30726 WP_001078309.1.30758 WP_001078309.1.30763 WP_001078309.1.30768 WP_001078309.1.3077 WP_001078309.1.30779 WP_001078309.1.30845 WP_001078309.1.30846 WP_001078309.1.30847 WP_001078309.1.30854 WP_001078309.1.30861 WP_001078309.1.30862 WP_001078309.1.30863 WP_001078309.1.30874 WP_001078309.1.30878 WP_001078309.1.30889 WP_001078309.1.30911 WP_001078309.1.30915 WP_001078309.1.30916 WP_001078309.1.30945 WP_001078309.1.30962 WP_001078309.1.3097 WP_001078309.1.30970 WP_001078309.1.30971 WP_001078309.1.30998 WP_001078309.1.31005 WP_001078309.1.31022 WP_001078309.1.31037 WP_001078309.1.31039 WP_001078309.1.31048 WP_001078309.1.31068 WP_001078309.1.31091 WP_001078309.1.31114 WP_001078309.1.31120 WP_001078309.1.31123 WP_001078309.1.31124 WP_001078309.1.31176 WP_001078309.1.31194 WP_001078309.1.31202 WP_001078309.1.31206 WP_001078309.1.31212 WP_001078309.1.3123 WP_001078309.1.31232 WP_001078309.1.31294 WP_001078309.1.31315 WP_001078309.1.3132 WP_001078309.1.31337 WP_001078309.1.31339 WP_001078309.1.31355 WP_001078309.1.31363 WP_001078309.1.31376 WP_001078309.1.31377 WP_001078309.1.31402 WP_001078309.1.31424 WP_001078309.1.31426 WP_001078309.1.31436 WP_001078309.1.31437 WP_001078309.1.31442 WP_001078309.1.31462 WP_001078309.1.31468 WP_001078309.1.31478 WP_001078309.1.31479 WP_001078309.1.31484 WP_001078309.1.315 WP_001078309.1.31505 WP_001078309.1.31529 WP_001078309.1.31531 WP_001078309.1.31539 WP_001078309.1.31567 WP_001078309.1.31611 WP_001078309.1.31638 WP_001078309.1.31642 WP_001078309.1.31647 WP_001078309.1.31653 WP_001078309.1.31667 WP_001078309.1.31686 WP_001078309.1.31701 WP_001078309.1.31753 WP_001078309.1.31787 WP_001078309.1.31791 WP_001078309.1.31797 WP_001078309.1.31806 WP_001078309.1.31817 WP_001078309.1.31827 WP_001078309.1.31828 WP_001078309.1.31842 WP_001078309.1.31892 WP_001078309.1.31897 WP_001078309.1.31925 WP_001078309.1.31931 WP_001078309.1.31943 WP_001078309.1.31949 WP_001078309.1.31990 WP_001078309.1.31994 WP_001078309.1.31997 WP_001078309.1.32003 WP_001078309.1.32005 WP_001078309.1.32029 WP_001078309.1.32040 WP_001078309.1.32059 WP_001078309.1.32067 WP_001078309.1.32095 WP_001078309.1.32106 WP_001078309.1.32118 WP_001078309.1.32122 WP_001078309.1.32125 WP_001078309.1.32130 WP_001078309.1.32160 WP_001078309.1.32167 WP_001078309.1.3219 WP_001078309.1.32207 WP_001078309.1.32215 WP_001078309.1.32217 WP_001078309.1.32244 WP_001078309.1.32248 WP_001078309.1.32269 WP_001078309.1.32270 WP_001078309.1.32281 WP_001078309.1.3229 WP_001078309.1.32295 WP_001078309.1.32301 WP_001078309.1.32325 WP_001078309.1.32338 WP_001078309.1.32339 WP_001078309.1.32340 WP_001078309.1.32348 WP_001078309.1.32365 WP_001078309.1.32384 WP_001078309.1.32405 WP_001078309.1.3242 WP_001078309.1.3244 WP_001078309.1.32454 WP_001078309.1.32464 WP_001078309.1.32474 WP_001078309.1.32481 WP_001078309.1.32483 WP_001078309.1.32497 WP_001078309.1.32514 WP_001078309.1.32517 WP_001078309.1.32534 WP_001078309.1.32546 WP_001078309.1.32555 WP_001078309.1.32565 WP_001078309.1.32584 WP_001078309.1.32588 WP_001078309.1.32607 WP_001078309.1.32634 WP_001078309.1.32636 WP_001078309.1.32739 WP_001078309.1.32746 WP_001078309.1.32754 WP_001078309.1.32764 WP_001078309.1.32770 WP_001078309.1.32795 WP_001078309.1.328 WP_001078309.1.32800 WP_001078309.1.32839 WP_001078309.1.32898 WP_001078309.1.32921 WP_001078309.1.32925 WP_001078309.1.32928 WP_001078309.1.3293 WP_001078309.1.32939 WP_001078309.1.32954 WP_001078309.1.32965 WP_001078309.1.32980 WP_001078309.1.32987 WP_001078309.1.3299 WP_001078309.1.3301 WP_001078309.1.33038 WP_001078309.1.33048 WP_001078309.1.3306 WP_001078309.1.33067 WP_001078309.1.33108 WP_001078309.1.33110 WP_001078309.1.33123 WP_001078309.1.33138 WP_001078309.1.33147 WP_001078309.1.33161 WP_001078309.1.33199 WP_001078309.1.33212 WP_001078309.1.33213 WP_001078309.1.33250 WP_001078309.1.33252 WP_001078309.1.33255 WP_001078309.1.33266 WP_001078309.1.33277 WP_001078309.1.33292 WP_001078309.1.33296 WP_001078309.1.33307 WP_001078309.1.33335 WP_001078309.1.3335 WP_001078309.1.33350 WP_001078309.1.33357 WP_001078309.1.33368 WP_001078309.1.33372 WP_001078309.1.3338 WP_001078309.1.33388 WP_001078309.1.33394 WP_001078309.1.33416 WP_001078309.1.3342 WP_001078309.1.33426 WP_001078309.1.33432 WP_001078309.1.3345 WP_001078309.1.33463 WP_001078309.1.33468 WP_001078309.1.3347 WP_001078309.1.33483 WP_001078309.1.33484 WP_001078309.1.33507 WP_001078309.1.33516 WP_001078309.1.33518 WP_001078309.1.33520 WP_001078309.1.33540 WP_001078309.1.3357 WP_001078309.1.33575 WP_001078309.1.3358 WP_001078309.1.33594 WP_001078309.1.33610 WP_001078309.1.33626 WP_001078309.1.33627 WP_001078309.1.3363 WP_001078309.1.33640 WP_001078309.1.33650 WP_001078309.1.33654 WP_001078309.1.33692 WP_001078309.1.33695 WP_001078309.1.33718 WP_001078309.1.33720 WP_001078309.1.33724 WP_001078309.1.33735 WP_001078309.1.33737 WP_001078309.1.33743 WP_001078309.1.33756 WP_001078309.1.33765 WP_001078309.1.33766 WP_001078309.1.33769 WP_001078309.1.33778 WP_001078309.1.33792 WP_001078309.1.33804 WP_001078309.1.33813 WP_001078309.1.33816 WP_001078309.1.33855 WP_001078309.1.33899 WP_001078309.1.33915 WP_001078309.1.33940 WP_001078309.1.33949 WP_001078309.1.33963 WP_001078309.1.33968 WP_001078309.1.33971 WP_001078309.1.33983 WP_001078309.1.33994 WP_001078309.1.34026 WP_001078309.1.34030 WP_001078309.1.34051 WP_001078309.1.34062 WP_001078309.1.34069 WP_001078309.1.34079 WP_001078309.1.34089 WP_001078309.1.34100 WP_001078309.1.34105 WP_001078309.1.34112 WP_001078309.1.34128 WP_001078309.1.34132 WP_001078309.1.34168 WP_001078309.1.34172 WP_001078309.1.3418 WP_001078309.1.34182 WP_001078309.1.34194 WP_001078309.1.34209 WP_001078309.1.3422 WP_001078309.1.34223 WP_001078309.1.34231 WP_001078309.1.34244 WP_001078309.1.34249 WP_001078309.1.34250 WP_001078309.1.34251 WP_001078309.1.34285 WP_001078309.1.34307 WP_001078309.1.34334 WP_001078309.1.34361 WP_001078309.1.34381 WP_001078309.1.34403 WP_001078309.1.34410 WP_001078309.1.3442 WP_001078309.1.34436 WP_001078309.1.34438 WP_001078309.1.34471 WP_001078309.1.3448 WP_001078309.1.34482 WP_001078309.1.34492 WP_001078309.1.34502 WP_001078309.1.34510 WP_001078309.1.34512 WP_001078309.1.34526 WP_001078309.1.34531 WP_001078309.1.34569 WP_001078309.1.34578 WP_001078309.1.3461 WP_001078309.1.34626 WP_001078309.1.34666 WP_001078309.1.34677 WP_001078309.1.34716 WP_001078309.1.34723 WP_001078309.1.34737 WP_001078309.1.3474 WP_001078309.1.34741 WP_001078309.1.34767 WP_001078309.1.34818 WP_001078309.1.34847 WP_001078309.1.34865 WP_001078309.1.34877 WP_001078309.1.34890 WP_001078309.1.34918 WP_001078309.1.34923 WP_001078309.1.34926 WP_001078309.1.34967 WP_001078309.1.34970 WP_001078309.1.34998 WP_001078309.1.35014 WP_001078309.1.35029 WP_001078309.1.35031 WP_001078309.1.35032 WP_001078309.1.35059 WP_001078309.1.35062 WP_001078309.1.35089 WP_001078309.1.35097 WP_001078309.1.35106 WP_001078309.1.35108 WP_001078309.1.35110 WP_001078309.1.35121 WP_001078309.1.35177 WP_001078309.1.35183 WP_001078309.1.35189 WP_001078309.1.35222 WP_001078309.1.35233 WP_001078309.1.35243 WP_001078309.1.35257 WP_001078309.1.3526 WP_001078309.1.35264 WP_001078309.1.35276 WP_001078309.1.35285 WP_001078309.1.35289 WP_001078309.1.35297 WP_001078309.1.35307 WP_001078309.1.35314 WP_001078309.1.35334 WP_001078309.1.35340 WP_001078309.1.35342 WP_001078309.1.35345 WP_001078309.1.35352 WP_001078309.1.35391 WP_001078309.1.354 WP_001078309.1.35413 WP_001078309.1.35415 WP_001078309.1.3542 WP_001078309.1.35433 WP_001078309.1.35435 WP_001078309.1.3547 WP_001078309.1.35490 WP_001078309.1.35497 WP_001078309.1.35498 WP_001078309.1.35508 WP_001078309.1.35519 WP_001078309.1.3552 WP_001078309.1.35525 WP_001078309.1.35549 WP_001078309.1.35580 WP_001078309.1.35615 WP_001078309.1.35623 WP_001078309.1.35642 WP_001078309.1.35643 WP_001078309.1.35659 WP_001078309.1.35661 WP_001078309.1.35673 WP_001078309.1.35686 WP_001078309.1.3569 WP_001078309.1.35696 WP_001078309.1.35746 WP_001078309.1.35774 WP_001078309.1.35784 WP_001078309.1.3579 WP_001078309.1.35794 WP_001078309.1.35799 WP_001078309.1.35801 WP_001078309.1.35826 WP_001078309.1.35837 WP_001078309.1.35888 WP_001078309.1.35890 WP_001078309.1.35900 WP_001078309.1.35903 WP_001078309.1.35928 WP_001078309.1.35933 WP_001078309.1.35950 WP_001078309.1.36004 WP_001078309.1.36021 WP_001078309.1.36082 WP_001078309.1.36093 WP_001078309.1.36102 WP_001078309.1.36117 WP_001078309.1.36119 WP_001078309.1.36141 WP_001078309.1.3617 WP_001078309.1.36175 WP_001078309.1.36176 WP_001078309.1.36179 WP_001078309.1.36187 WP_001078309.1.36188 WP_001078309.1.36193 WP_001078309.1.36208 WP_001078309.1.36211 WP_001078309.1.36220 WP_001078309.1.36223 WP_001078309.1.3623 WP_001078309.1.36231 WP_001078309.1.36249 WP_001078309.1.36250 WP_001078309.1.36264 WP_001078309.1.36278 WP_001078309.1.36282 WP_001078309.1.36283 WP_001078309.1.36302 WP_001078309.1.36307 WP_001078309.1.36325 WP_001078309.1.36344 WP_001078309.1.36389 WP_001078309.1.36430 WP_001078309.1.36434 WP_001078309.1.36439 WP_001078309.1.36522 WP_001078309.1.36532 WP_001078309.1.36535 WP_001078309.1.3655 WP_001078309.1.36551 WP_001078309.1.36570 WP_001078309.1.36580 WP_001078309.1.36600 WP_001078309.1.36604 WP_001078309.1.36615 WP_001078309.1.36640 WP_001078309.1.36646 WP_001078309.1.3666 WP_001078309.1.36669 WP_001078309.1.36689 WP_001078309.1.36697 WP_001078309.1.36704 WP_001078309.1.36729 WP_001078309.1.36745 WP_001078309.1.3675 WP_001078309.1.36770 WP_001078309.1.36773 WP_001078309.1.36783 WP_001078309.1.36793 WP_001078309.1.36796 WP_001078309.1.36809 WP_001078309.1.36814 WP_001078309.1.36820 WP_001078309.1.36822 WP_001078309.1.36823 WP_001078309.1.36847 WP_001078309.1.3685 WP_001078309.1.36858 WP_001078309.1.3687 WP_001078309.1.36884 WP_001078309.1.36888 WP_001078309.1.36903 WP_001078309.1.36911 WP_001078309.1.36932 WP_001078309.1.36952 WP_001078309.1.36955 WP_001078309.1.36979 WP_001078309.1.36980 WP_001078309.1.36983 WP_001078309.1.36997 WP_001078309.1.37002 WP_001078309.1.37016 WP_001078309.1.3703 WP_001078309.1.37044 WP_001078309.1.37053 WP_001078309.1.37055 WP_001078309.1.37080 WP_001078309.1.3709 WP_001078309.1.37120 WP_001078309.1.37121 WP_001078309.1.37130 WP_001078309.1.37132 WP_001078309.1.37134 WP_001078309.1.37135 WP_001078309.1.37145 WP_001078309.1.37159 WP_001078309.1.3722 WP_001078309.1.37220 WP_001078309.1.37240 WP_001078309.1.37304 WP_001078309.1.37335 WP_001078309.1.37336 WP_001078309.1.37341 WP_001078309.1.37343 WP_001078309.1.37354 WP_001078309.1.37378 WP_001078309.1.37398 WP_001078309.1.37408 WP_001078309.1.37411 WP_001078309.1.37424 WP_001078309.1.37435 WP_001078309.1.37467 WP_001078309.1.37503 WP_001078309.1.37525 WP_001078309.1.37536 WP_001078309.1.37546 WP_001078309.1.37563 WP_001078309.1.37578 WP_001078309.1.37583 WP_001078309.1.37602 WP_001078309.1.37605 WP_001078309.1.37606 WP_001078309.1.37624 WP_001078309.1.37636 WP_001078309.1.37644 WP_001078309.1.37652 WP_001078309.1.37669 WP_001078309.1.37679 WP_001078309.1.3774 WP_001078309.1.37749 WP_001078309.1.3776 WP_001078309.1.37764 WP_001078309.1.37771 WP_001078309.1.37781 WP_001078309.1.37788 WP_001078309.1.37795 WP_001078309.1.37815 WP_001078309.1.37828 WP_001078309.1.3784 WP_001078309.1.37851 WP_001078309.1.37878 WP_001078309.1.37906 WP_001078309.1.37929 WP_001078309.1.37953 WP_001078309.1.37987 WP_001078309.1.38007 WP_001078309.1.38030 WP_001078309.1.38038 WP_001078309.1.38057 WP_001078309.1.38070 WP_001078309.1.38082 WP_001078309.1.3809 WP_001078309.1.38100 WP_001078309.1.38111 WP_001078309.1.38128 WP_001078309.1.38136 WP_001078309.1.38148 WP_001078309.1.38160 WP_001078309.1.38177 WP_001078309.1.3820 WP_001078309.1.38212 WP_001078309.1.38222 WP_001078309.1.38230 WP_001078309.1.38232 WP_001078309.1.3827 WP_001078309.1.38276 WP_001078309.1.38282 WP_001078309.1.38304 WP_001078309.1.38309 WP_001078309.1.38311 WP_001078309.1.38316 WP_001078309.1.38330 WP_001078309.1.38336 WP_001078309.1.38339 WP_001078309.1.38346 WP_001078309.1.38383 WP_001078309.1.38390 WP_001078309.1.3842 WP_001078309.1.38435 WP_001078309.1.38437 WP_001078309.1.38453 WP_001078309.1.38489 WP_001078309.1.38491 WP_001078309.1.38493 WP_001078309.1.3850 WP_001078309.1.38516 WP_001078309.1.3852 WP_001078309.1.38522 WP_001078309.1.38546 WP_001078309.1.38551 WP_001078309.1.38555 WP_001078309.1.38600 WP_001078309.1.38607 WP_001078309.1.38612 WP_001078309.1.38637 WP_001078309.1.38651 WP_001078309.1.38658 WP_001078309.1.38669 WP_001078309.1.3867 WP_001078309.1.38674 WP_001078309.1.38688 WP_001078309.1.38721 WP_001078309.1.3875 WP_001078309.1.38760 WP_001078309.1.38788 WP_001078309.1.38823 WP_001078309.1.38836 WP_001078309.1.38841 WP_001078309.1.38858 WP_001078309.1.38862 WP_001078309.1.38875 WP_001078309.1.38885 WP_001078309.1.38890 WP_001078309.1.38926 WP_001078309.1.38927 WP_001078309.1.38931 WP_001078309.1.3894 WP_001078309.1.38940 WP_001078309.1.38941 WP_001078309.1.38960 WP_001078309.1.38972 WP_001078309.1.38973 WP_001078309.1.38989 WP_001078309.1.390 WP_001078309.1.39012 WP_001078309.1.39014 WP_001078309.1.39017 WP_001078309.1.39020 WP_001078309.1.39026 WP_001078309.1.39043 WP_001078309.1.39053 WP_001078309.1.3906 WP_001078309.1.39080 WP_001078309.1.39089 WP_001078309.1.391 WP_001078309.1.39108 WP_001078309.1.39117 WP_001078309.1.39126 WP_001078309.1.39166 WP_001078309.1.39173 WP_001078309.1.39203 WP_001078309.1.39206 WP_001078309.1.39217 WP_001078309.1.3926 WP_001078309.1.39272 WP_001078309.1.39281 WP_001078309.1.39290 WP_001078309.1.39324 WP_001078309.1.39330 WP_001078309.1.39332 WP_001078309.1.39333 WP_001078309.1.39347 WP_001078309.1.39361 WP_001078309.1.39368 WP_001078309.1.39397 WP_001078309.1.39406 WP_001078309.1.39432 WP_001078309.1.39451 WP_001078309.1.39486 WP_001078309.1.39499 WP_001078309.1.39506 WP_001078309.1.39527 WP_001078309.1.39542 WP_001078309.1.39550 WP_001078309.1.39625 WP_001078309.1.39642 WP_001078309.1.39645 WP_001078309.1.39662 WP_001078309.1.39670 WP_001078309.1.39671 WP_001078309.1.39682 WP_001078309.1.39687 WP_001078309.1.39689 WP_001078309.1.39693 WP_001078309.1.39697 WP_001078309.1.39711 WP_001078309.1.39738 WP_001078309.1.39767 WP_001078309.1.39773 WP_001078309.1.39789 WP_001078309.1.39812 WP_001078309.1.39832 WP_001078309.1.39834 WP_001078309.1.39838 WP_001078309.1.39839 WP_001078309.1.39847 WP_001078309.1.39856 WP_001078309.1.39857 WP_001078309.1.39869 WP_001078309.1.39875 WP_001078309.1.39880 WP_001078309.1.39883 WP_001078309.1.39918 WP_001078309.1.39943 WP_001078309.1.39995 WP_001078309.1.40014 WP_001078309.1.40043 WP_001078309.1.40053 WP_001078309.1.4006 WP_001078309.1.40076 WP_001078309.1.40085 WP_001078309.1.40099 WP_001078309.1.4010 WP_001078309.1.40119 WP_001078309.1.4012 WP_001078309.1.40120 WP_001078309.1.40130 WP_001078309.1.40137 WP_001078309.1.40149 WP_001078309.1.4015 WP_001078309.1.40161 WP_001078309.1.40164 WP_001078309.1.40173 WP_001078309.1.4019 WP_001078309.1.40220 WP_001078309.1.40247 WP_001078309.1.4025 WP_001078309.1.40299 WP_001078309.1.40316 WP_001078309.1.40318 WP_001078309.1.40320 WP_001078309.1.40322 WP_001078309.1.40329 WP_001078309.1.40330 WP_001078309.1.40340 WP_001078309.1.40342 WP_001078309.1.40368 WP_001078309.1.40369 WP_001078309.1.40406 WP_001078309.1.40409 WP_001078309.1.40428 WP_001078309.1.40435 WP_001078309.1.40443 WP_001078309.1.4045 WP_001078309.1.40454 WP_001078309.1.40458 WP_001078309.1.40463 WP_001078309.1.40472 WP_001078309.1.40474 WP_001078309.1.40481 WP_001078309.1.40483 WP_001078309.1.40500 WP_001078309.1.40505 WP_001078309.1.40531 WP_001078309.1.40532 WP_001078309.1.4056 WP_001078309.1.4057 WP_001078309.1.40579 WP_001078309.1.40588 WP_001078309.1.40613 WP_001078309.1.40620 WP_001078309.1.40644 WP_001078309.1.40655 WP_001078309.1.40658 WP_001078309.1.40659 WP_001078309.1.40670 WP_001078309.1.40700 WP_001078309.1.40719 WP_001078309.1.40729 WP_001078309.1.40760 WP_001078309.1.4078 WP_001078309.1.40780 WP_001078309.1.40794 WP_001078309.1.40797 WP_001078309.1.40814 WP_001078309.1.40816 WP_001078309.1.40939 WP_001078309.1.40954 WP_001078309.1.40997 WP_001078309.1.41002 WP_001078309.1.41033 WP_001078309.1.41038 WP_001078309.1.4105 WP_001078309.1.41064 WP_001078309.1.41084 WP_001078309.1.41094 WP_001078309.1.41098 WP_001078309.1.41109 WP_001078309.1.41119 WP_001078309.1.41129 WP_001078309.1.4115 WP_001078309.1.41178 WP_001078309.1.412 WP_001078309.1.41208 WP_001078309.1.41238 WP_001078309.1.41241 WP_001078309.1.41245 WP_001078309.1.41255 WP_001078309.1.41288 WP_001078309.1.41289 WP_001078309.1.4129 WP_001078309.1.41314 WP_001078309.1.41341 WP_001078309.1.41350 WP_001078309.1.41374 WP_001078309.1.4138 WP_001078309.1.41386 WP_001078309.1.41389 WP_001078309.1.41411 WP_001078309.1.41426 WP_001078309.1.41432 WP_001078309.1.41433 WP_001078309.1.41444 WP_001078309.1.41448 WP_001078309.1.41456 WP_001078309.1.41461 WP_001078309.1.41499 WP_001078309.1.41511 WP_001078309.1.41537 WP_001078309.1.41555 WP_001078309.1.41558 WP_001078309.1.41567 WP_001078309.1.41581 WP_001078309.1.41582 WP_001078309.1.41587 WP_001078309.1.41597 WP_001078309.1.41598 WP_001078309.1.41599 WP_001078309.1.4160 WP_001078309.1.41612 WP_001078309.1.4162 WP_001078309.1.41620 WP_001078309.1.41623 WP_001078309.1.41647 WP_001078309.1.41674 WP_001078309.1.41681 WP_001078309.1.4169 WP_001078309.1.41698 WP_001078309.1.41726 WP_001078309.1.41743 WP_001078309.1.41755 WP_001078309.1.41770 WP_001078309.1.41796 WP_001078309.1.4182 WP_001078309.1.41821 WP_001078309.1.41839 WP_001078309.1.41863 WP_001078309.1.4188 WP_001078309.1.41898 WP_001078309.1.41906 WP_001078309.1.41935 WP_001078309.1.41943 WP_001078309.1.41954 WP_001078309.1.41972 WP_001078309.1.41989 WP_001078309.1.420 WP_001078309.1.42003 WP_001078309.1.42005 WP_001078309.1.42015 WP_001078309.1.42017 WP_001078309.1.4202 WP_001078309.1.42028 WP_001078309.1.42056 WP_001078309.1.42064 WP_001078309.1.42072 WP_001078309.1.42085 WP_001078309.1.42087 WP_001078309.1.42125 WP_001078309.1.42137 WP_001078309.1.42169 WP_001078309.1.42177 WP_001078309.1.42178 WP_001078309.1.42198 WP_001078309.1.42241 WP_001078309.1.4225 WP_001078309.1.42269 WP_001078309.1.42286 WP_001078309.1.42298 WP_001078309.1.42305 WP_001078309.1.4231 WP_001078309.1.42325 WP_001078309.1.42336 WP_001078309.1.42344 WP_001078309.1.42355 WP_001078309.1.42403 WP_001078309.1.42436 WP_001078309.1.42438 WP_001078309.1.42455 WP_001078309.1.42459 WP_001078309.1.42481 WP_001078309.1.42503 WP_001078309.1.42510 WP_001078309.1.42517 WP_001078309.1.42575 WP_001078309.1.42593 WP_001078309.1.42598 WP_001078309.1.426 WP_001078309.1.4260 WP_001078309.1.42607 WP_001078309.1.42640 WP_001078309.1.42652 WP_001078309.1.42667 WP_001078309.1.42668 WP_001078309.1.42674 WP_001078309.1.42679 WP_001078309.1.42681 WP_001078309.1.42706 WP_001078309.1.42733 WP_001078309.1.42737 WP_001078309.1.42759 WP_001078309.1.42764 WP_001078309.1.42786 WP_001078309.1.42788 WP_001078309.1.42798 WP_001078309.1.42802 WP_001078309.1.42816 WP_001078309.1.42837 WP_001078309.1.42897 WP_001078309.1.42907 WP_001078309.1.42924 WP_001078309.1.42925 WP_001078309.1.4293 WP_001078309.1.42959 WP_001078309.1.42982 WP_001078309.1.42984 WP_001078309.1.42985 WP_001078309.1.4299 WP_001078309.1.42990 WP_001078309.1.4300 WP_001078309.1.43014 WP_001078309.1.43023 WP_001078309.1.43033 WP_001078309.1.43047 WP_001078309.1.43061 WP_001078309.1.43072 WP_001078309.1.43095 WP_001078309.1.43110 WP_001078309.1.43122 WP_001078309.1.43125 WP_001078309.1.43131 WP_001078309.1.43134 WP_001078309.1.43139 WP_001078309.1.43143 WP_001078309.1.43147 WP_001078309.1.43159 WP_001078309.1.43165 WP_001078309.1.43168 WP_001078309.1.43179 WP_001078309.1.43202 WP_001078309.1.43204 WP_001078309.1.43220 WP_001078309.1.43225 WP_001078309.1.43232 WP_001078309.1.43248 WP_001078309.1.4325 WP_001078309.1.43252 WP_001078309.1.43263 WP_001078309.1.4327 WP_001078309.1.43274 WP_001078309.1.43279 WP_001078309.1.43323 WP_001078309.1.43325 WP_001078309.1.43328 WP_001078309.1.43331 WP_001078309.1.43341 WP_001078309.1.43349 WP_001078309.1.43360 WP_001078309.1.43366 WP_001078309.1.43369 WP_001078309.1.4337 WP_001078309.1.43375 WP_001078309.1.43383 WP_001078309.1.43405 WP_001078309.1.43406 WP_001078309.1.4341 WP_001078309.1.43410 WP_001078309.1.43414 WP_001078309.1.43446 WP_001078309.1.43460 WP_001078309.1.4347 WP_001078309.1.43512 WP_001078309.1.43530 WP_001078309.1.43550 WP_001078309.1.43560 WP_001078309.1.43573 WP_001078309.1.43594 WP_001078309.1.43600 WP_001078309.1.43617 WP_001078309.1.43618 WP_001078309.1.43627 WP_001078309.1.43659 WP_001078309.1.43665 WP_001078309.1.43670 WP_001078309.1.43683 WP_001078309.1.4369 WP_001078309.1.43693 WP_001078309.1.4370 WP_001078309.1.43702 WP_001078309.1.43703 WP_001078309.1.4372 WP_001078309.1.43731 WP_001078309.1.4374 WP_001078309.1.43752 WP_001078309.1.43784 WP_001078309.1.43788 WP_001078309.1.4379 WP_001078309.1.4380 WP_001078309.1.43800 WP_001078309.1.43819 WP_001078309.1.43822 WP_001078309.1.43827 WP_001078309.1.4385 WP_001078309.1.43851 WP_001078309.1.4386 WP_001078309.1.43904 WP_001078309.1.43915 WP_001078309.1.43924 WP_001078309.1.43964 WP_001078309.1.43984 WP_001078309.1.43995 WP_001078309.1.44021 WP_001078309.1.44072 WP_001078309.1.44074 WP_001078309.1.44119 WP_001078309.1.44150 WP_001078309.1.44153 WP_001078309.1.44177 WP_001078309.1.44178 WP_001078309.1.44181 WP_001078309.1.44195 WP_001078309.1.44255 WP_001078309.1.44265 WP_001078309.1.44302 WP_001078309.1.44312 WP_001078309.1.44344 WP_001078309.1.44382 WP_001078309.1.44388 WP_001078309.1.44396 WP_001078309.1.44405 WP_001078309.1.44420 WP_001078309.1.44432 WP_001078309.1.44455 WP_001078309.1.44480 WP_001078309.1.44493 WP_001078309.1.44504 WP_001078309.1.44515 WP_001078309.1.44517 WP_001078309.1.44520 WP_001078309.1.44544 WP_001078309.1.44547 WP_001078309.1.44579 WP_001078309.1.44586 WP_001078309.1.44588 WP_001078309.1.44605 WP_001078309.1.44623 WP_001078309.1.44631 WP_001078309.1.44646 WP_001078309.1.44655 WP_001078309.1.44667 WP_001078309.1.44672 WP_001078309.1.44674 WP_001078309.1.447 WP_001078309.1.44714 WP_001078309.1.44715 WP_001078309.1.44732 WP_001078309.1.44755 WP_001078309.1.44768 WP_001078309.1.44780 WP_001078309.1.44785 WP_001078309.1.44788 WP_001078309.1.44796 WP_001078309.1.44802 WP_001078309.1.44853 WP_001078309.1.44856 WP_001078309.1.44868 WP_001078309.1.44876 WP_001078309.1.44881 WP_001078309.1.44882 WP_001078309.1.44891 WP_001078309.1.44892 WP_001078309.1.44899 WP_001078309.1.44903 WP_001078309.1.44914 WP_001078309.1.44932 WP_001078309.1.44940 WP_001078309.1.44948 WP_001078309.1.44955 WP_001078309.1.44969 WP_001078309.1.44993 WP_001078309.1.45010 WP_001078309.1.45015 WP_001078309.1.45033 WP_001078309.1.45035 WP_001078309.1.45042 WP_001078309.1.45050 WP_001078309.1.45080 WP_001078309.1.45091 WP_001078309.1.45094 WP_001078309.1.45099 WP_001078309.1.45101 WP_001078309.1.45111 WP_001078309.1.45131 WP_001078309.1.45132 WP_001078309.1.45133 WP_001078309.1.45140 WP_001078309.1.45157 WP_001078309.1.45162 WP_001078309.1.45164 WP_001078309.1.45170 WP_001078309.1.45188 WP_001078309.1.45189 WP_001078309.1.452 WP_001078309.1.45218 WP_001078309.1.45223 WP_001078309.1.45242 WP_001078309.1.45267 WP_001078309.1.4527 WP_001078309.1.45272 WP_001078309.1.45281 WP_001078309.1.45290 WP_001078309.1.45297 WP_001078309.1.453 WP_001078309.1.45303 WP_001078309.1.45321 WP_001078309.1.45332 WP_001078309.1.45364 WP_001078309.1.45419 WP_001078309.1.45431 WP_001078309.1.45439 WP_001078309.1.45447 WP_001078309.1.4545 WP_001078309.1.45450 WP_001078309.1.45456 WP_001078309.1.4546 WP_001078309.1.45472 WP_001078309.1.45492 WP_001078309.1.4550 WP_001078309.1.45507 WP_001078309.1.45542 WP_001078309.1.45555 WP_001078309.1.45560 WP_001078309.1.45574 WP_001078309.1.45577 WP_001078309.1.45586 WP_001078309.1.45610 WP_001078309.1.45620 WP_001078309.1.45640 WP_001078309.1.45645 WP_001078309.1.45654 WP_001078309.1.45670 WP_001078309.1.45698 WP_001078309.1.45703 WP_001078309.1.45705 WP_001078309.1.45713 WP_001078309.1.45730 WP_001078309.1.45747 WP_001078309.1.45763 WP_001078309.1.45768 WP_001078309.1.4577 WP_001078309.1.45771 WP_001078309.1.45773 WP_001078309.1.45780 WP_001078309.1.4580 WP_001078309.1.4582 WP_001078309.1.45822 WP_001078309.1.4584 WP_001078309.1.45852 WP_001078309.1.45859 WP_001078309.1.45862 WP_001078309.1.45870 WP_001078309.1.45874 WP_001078309.1.45875 WP_001078309.1.45881 WP_001078309.1.45897 WP_001078309.1.459 WP_001078309.1.45954 WP_001078309.1.4597 WP_001078309.1.45972 WP_001078309.1.45977 WP_001078309.1.45979 WP_001078309.1.4598 WP_001078309.1.46003 WP_001078309.1.46005 WP_001078309.1.46035 WP_001078309.1.46037 WP_001078309.1.46050 WP_001078309.1.46055 WP_001078309.1.46062 WP_001078309.1.46071 WP_001078309.1.46078 WP_001078309.1.46082 WP_001078309.1.46087 WP_001078309.1.46106 WP_001078309.1.46136 WP_001078309.1.46168 WP_001078309.1.46171 WP_001078309.1.46172 WP_001078309.1.46195 WP_001078309.1.46208 WP_001078309.1.46212 WP_001078309.1.46222 WP_001078309.1.46228 WP_001078309.1.46248 WP_001078309.1.46276 WP_001078309.1.46320 WP_001078309.1.46330 WP_001078309.1.46333 WP_001078309.1.46334 WP_001078309.1.46339 WP_001078309.1.46353 WP_001078309.1.46362 WP_001078309.1.46368 WP_001078309.1.46380 WP_001078309.1.46389 WP_001078309.1.46401 WP_001078309.1.46418 WP_001078309.1.46422 WP_001078309.1.46457 WP_001078309.1.46465 WP_001078309.1.46488 WP_001078309.1.46514 WP_001078309.1.46528 WP_001078309.1.46529 WP_001078309.1.46534 WP_001078309.1.46543 WP_001078309.1.46576 WP_001078309.1.46587 WP_001078309.1.46608 WP_001078309.1.46619 WP_001078309.1.4662 WP_001078309.1.46648 WP_001078309.1.46660 WP_001078309.1.46664 WP_001078309.1.46670 WP_001078309.1.46676 WP_001078309.1.46688 WP_001078309.1.46692 WP_001078309.1.46702 WP_001078309.1.46703 WP_001078309.1.46720 WP_001078309.1.46736 WP_001078309.1.46752 WP_001078309.1.46765 WP_001078309.1.46767 WP_001078309.1.46770 WP_001078309.1.46772 WP_001078309.1.4680 WP_001078309.1.46815 WP_001078309.1.46823 WP_001078309.1.46837 WP_001078309.1.46852 WP_001078309.1.46875 WP_001078309.1.46881 WP_001078309.1.46906 WP_001078309.1.46908 WP_001078309.1.46911 WP_001078309.1.46914 WP_001078309.1.46925 WP_001078309.1.46929 WP_001078309.1.46937 WP_001078309.1.4694 WP_001078309.1.46947 WP_001078309.1.4696 WP_001078309.1.46964 WP_001078309.1.46983 WP_001078309.1.46995 WP_001078309.1.47002 WP_001078309.1.47051 WP_001078309.1.47065 WP_001078309.1.47090 WP_001078309.1.47107 WP_001078309.1.47111 WP_001078309.1.47128 WP_001078309.1.47153 WP_001078309.1.47159 WP_001078309.1.4716 WP_001078309.1.47175 WP_001078309.1.47187 WP_001078309.1.47193 WP_001078309.1.47205 WP_001078309.1.47211 WP_001078309.1.47216 WP_001078309.1.47218 WP_001078309.1.47250 WP_001078309.1.47258 WP_001078309.1.47269 WP_001078309.1.47279 WP_001078309.1.4728 WP_001078309.1.47282 WP_001078309.1.47290 WP_001078309.1.47294 WP_001078309.1.47306 WP_001078309.1.47308 WP_001078309.1.47317 WP_001078309.1.47328 WP_001078309.1.47331 WP_001078309.1.47334 WP_001078309.1.47353 WP_001078309.1.47381 WP_001078309.1.47383 WP_001078309.1.47399 WP_001078309.1.47405 WP_001078309.1.47406 WP_001078309.1.47408 WP_001078309.1.47422 WP_001078309.1.47426 WP_001078309.1.47432 WP_001078309.1.47439 WP_001078309.1.47450 WP_001078309.1.47459 WP_001078309.1.47493 WP_001078309.1.4752 WP_001078309.1.47522 WP_001078309.1.47530 WP_001078309.1.47541 WP_001078309.1.47554 WP_001078309.1.47560 WP_001078309.1.47561 WP_001078309.1.47570 WP_001078309.1.47577 WP_001078309.1.47617 WP_001078309.1.47618 WP_001078309.1.47629 WP_001078309.1.47667 WP_001078309.1.47669 WP_001078309.1.4767 WP_001078309.1.47680 WP_001078309.1.477 WP_001078309.1.47702 WP_001078309.1.47733 WP_001078309.1.47747 WP_001078309.1.47763 WP_001078309.1.47782 WP_001078309.1.47792 WP_001078309.1.47821 WP_001078309.1.47835 WP_001078309.1.47836 WP_001078309.1.47859 WP_001078309.1.47872 WP_001078309.1.47873 WP_001078309.1.47888 WP_001078309.1.47901 WP_001078309.1.47904 WP_001078309.1.47908 WP_001078309.1.4792 WP_001078309.1.47951 WP_001078309.1.47980 WP_001078309.1.47996 WP_001078309.1.48009 WP_001078309.1.48011 WP_001078309.1.48013 WP_001078309.1.48017 WP_001078309.1.48030 WP_001078309.1.48046 WP_001078309.1.48047 WP_001078309.1.4805 WP_001078309.1.48057 WP_001078309.1.48064 WP_001078309.1.48067 WP_001078309.1.48116 WP_001078309.1.48142 WP_001078309.1.48149 WP_001078309.1.4815 WP_001078309.1.48154 WP_001078309.1.48156 WP_001078309.1.48169 WP_001078309.1.48186 WP_001078309.1.48187 WP_001078309.1.48197 WP_001078309.1.48199 WP_001078309.1.48205 WP_001078309.1.48212 WP_001078309.1.48223 WP_001078309.1.48227 WP_001078309.1.48236 WP_001078309.1.48250 WP_001078309.1.48272 WP_001078309.1.48282 WP_001078309.1.48284 WP_001078309.1.48293 WP_001078309.1.48307 WP_001078309.1.48310 WP_001078309.1.48322 WP_001078309.1.48326 WP_001078309.1.48335 WP_001078309.1.48338 WP_001078309.1.48364 WP_001078309.1.48376 WP_001078309.1.48391 WP_001078309.1.48394 WP_001078309.1.48398 WP_001078309.1.484 WP_001078309.1.4840 WP_001078309.1.48427 WP_001078309.1.48437 WP_001078309.1.48438 WP_001078309.1.48463 WP_001078309.1.48479 WP_001078309.1.48492 WP_001078309.1.4852 WP_001078309.1.48556 WP_001078309.1.48563 WP_001078309.1.48577 WP_001078309.1.48580 WP_001078309.1.48593 WP_001078309.1.48601 WP_001078309.1.48634 WP_001078309.1.48655 WP_001078309.1.48656 WP_001078309.1.48664 WP_001078309.1.48670 WP_001078309.1.4868 WP_001078309.1.48694 WP_001078309.1.48705 WP_001078309.1.48711 WP_001078309.1.48723 WP_001078309.1.48769 WP_001078309.1.48782 WP_001078309.1.48786 WP_001078309.1.48805 WP_001078309.1.48817 WP_001078309.1.48823 WP_001078309.1.48833 WP_001078309.1.48835 WP_001078309.1.48869 WP_001078309.1.48936 WP_001078309.1.48941 WP_001078309.1.48943 WP_001078309.1.48945 WP_001078309.1.48951 WP_001078309.1.48966 WP_001078309.1.48968 WP_001078309.1.48982 WP_001078309.1.48993 WP_001078309.1.48996 WP_001078309.1.4901 WP_001078309.1.49018 WP_001078309.1.49032 WP_001078309.1.4905 WP_001078309.1.49071 WP_001078309.1.49094 WP_001078309.1.49105 WP_001078309.1.49128 WP_001078309.1.49129 WP_001078309.1.49143 WP_001078309.1.49150 WP_001078309.1.49152 WP_001078309.1.49159 WP_001078309.1.4916 WP_001078309.1.49161 WP_001078309.1.49171 WP_001078309.1.4918 WP_001078309.1.49189 WP_001078309.1.49196 WP_001078309.1.49199 WP_001078309.1.4920 WP_001078309.1.49207 WP_001078309.1.4921 WP_001078309.1.49227 WP_001078309.1.4924 WP_001078309.1.49248 WP_001078309.1.49257 WP_001078309.1.49301 WP_001078309.1.49326 WP_001078309.1.49327 WP_001078309.1.49362 WP_001078309.1.49367 WP_001078309.1.49373 WP_001078309.1.49398 WP_001078309.1.49418 WP_001078309.1.4945 WP_001078309.1.49479 WP_001078309.1.49484 WP_001078309.1.4950 WP_001078309.1.49518 WP_001078309.1.49530 WP_001078309.1.49539 WP_001078309.1.49549 WP_001078309.1.49573 WP_001078309.1.49581 WP_001078309.1.49582 WP_001078309.1.496 WP_001078309.1.49603 WP_001078309.1.49605 WP_001078309.1.4962 WP_001078309.1.49643 WP_001078309.1.49653 WP_001078309.1.49658 WP_001078309.1.49669 WP_001078309.1.49671 WP_001078309.1.49672 WP_001078309.1.49690 WP_001078309.1.49707 WP_001078309.1.49728 WP_001078309.1.49730 WP_001078309.1.49732 WP_001078309.1.49742 WP_001078309.1.49745 WP_001078309.1.49757 WP_001078309.1.4980 WP_001078309.1.49800 WP_001078309.1.49819 WP_001078309.1.4982 WP_001078309.1.49825 WP_001078309.1.4984 WP_001078309.1.49860 WP_001078309.1.49863 WP_001078309.1.4987 WP_001078309.1.49871 WP_001078309.1.4989 WP_001078309.1.49894 WP_001078309.1.49907 WP_001078309.1.49912 WP_001078309.1.49917 WP_001078309.1.49918 WP_001078309.1.49921 WP_001078309.1.49934 WP_001078309.1.49935 WP_001078309.1.4994 WP_001078309.1.49943 WP_001078309.1.49951 WP_001078309.1.49970 WP_001078309.1.49982 WP_001078309.1.50013 WP_001078309.1.50023 WP_001078309.1.50028 WP_001078309.1.50038 WP_001078309.1.50039 WP_001078309.1.50061 WP_001078309.1.50064 WP_001078309.1.50071 WP_001078309.1.50076 WP_001078309.1.50117 WP_001078309.1.5013 WP_001078309.1.50138 WP_001078309.1.50145 WP_001078309.1.50175 WP_001078309.1.50178 WP_001078309.1.50192 WP_001078309.1.50212 WP_001078309.1.50217 WP_001078309.1.50219 WP_001078309.1.50261 WP_001078309.1.50291 WP_001078309.1.50313 WP_001078309.1.50314 WP_001078309.1.5035 WP_001078309.1.50356 WP_001078309.1.50367 WP_001078309.1.50369 WP_001078309.1.50377 WP_001078309.1.50388 WP_001078309.1.50424 WP_001078309.1.50425 WP_001078309.1.50430 WP_001078309.1.50440 WP_001078309.1.5045 WP_001078309.1.50464 WP_001078309.1.50477 WP_001078309.1.50525 WP_001078309.1.50527 WP_001078309.1.50536 WP_001078309.1.50543 WP_001078309.1.50555 WP_001078309.1.50558 WP_001078309.1.50568 WP_001078309.1.50578 WP_001078309.1.5059 WP_001078309.1.50594 WP_001078309.1.50595 WP_001078309.1.50647 WP_001078309.1.50660 WP_001078309.1.50699 WP_001078309.1.50711 WP_001078309.1.50732 WP_001078309.1.50740 WP_001078309.1.50742 WP_001078309.1.50745 WP_001078309.1.50748 WP_001078309.1.50768 WP_001078309.1.50799 WP_001078309.1.5080 WP_001078309.1.50817 WP_001078309.1.50820 WP_001078309.1.50829 WP_001078309.1.5087 WP_001078309.1.50884 WP_001078309.1.50896 WP_001078309.1.50937 WP_001078309.1.50958 WP_001078309.1.50962 WP_001078309.1.50974 WP_001078309.1.51015 WP_001078309.1.51031 WP_001078309.1.5108 WP_001078309.1.5109 WP_001078309.1.5110 WP_001078309.1.5111 WP_001078309.1.51130 WP_001078309.1.51152 WP_001078309.1.5117 WP_001078309.1.51194 WP_001078309.1.51209 WP_001078309.1.51220 WP_001078309.1.51226 WP_001078309.1.51236 WP_001078309.1.51245 WP_001078309.1.51250 WP_001078309.1.51271 WP_001078309.1.51277 WP_001078309.1.51282 WP_001078309.1.51295 WP_001078309.1.51306 WP_001078309.1.51310 WP_001078309.1.51326 WP_001078309.1.51346 WP_001078309.1.51365 WP_001078309.1.51376 WP_001078309.1.51377 WP_001078309.1.51393 WP_001078309.1.51403 WP_001078309.1.51418 WP_001078309.1.5145 WP_001078309.1.51454 WP_001078309.1.51456 WP_001078309.1.51465 WP_001078309.1.51469 WP_001078309.1.51492 WP_001078309.1.51496 WP_001078309.1.515 WP_001078309.1.51527 WP_001078309.1.5155 WP_001078309.1.51557 WP_001078309.1.51558 WP_001078309.1.51559 WP_001078309.1.51571 WP_001078309.1.51575 WP_001078309.1.51590 WP_001078309.1.51619 WP_001078309.1.51623 WP_001078309.1.51657 WP_001078309.1.51665 WP_001078309.1.51672 WP_001078309.1.51702 WP_001078309.1.51713 WP_001078309.1.51716 WP_001078309.1.51741 WP_001078309.1.51744 WP_001078309.1.51748 WP_001078309.1.51751 WP_001078309.1.51794 WP_001078309.1.51797 WP_001078309.1.51824 WP_001078309.1.51836 WP_001078309.1.51842 WP_001078309.1.51844 WP_001078309.1.5186 WP_001078309.1.51866 WP_001078309.1.51871 WP_001078309.1.51883 WP_001078309.1.51912 WP_001078309.1.51924 WP_001078309.1.51936 WP_001078309.1.51952 WP_001078309.1.51971 WP_001078309.1.51973 WP_001078309.1.51995 WP_001078309.1.52034 WP_001078309.1.52061 WP_001078309.1.52072 WP_001078309.1.52078 WP_001078309.1.5209 WP_001078309.1.521 WP_001078309.1.5213 WP_001078309.1.52151 WP_001078309.1.52182 WP_001078309.1.52185 WP_001078309.1.52193 WP_001078309.1.52195 WP_001078309.1.52198 WP_001078309.1.52210 WP_001078309.1.52224 WP_001078309.1.52251 WP_001078309.1.5228 WP_001078309.1.52289 WP_001078309.1.52296 WP_001078309.1.523 WP_001078309.1.52308 WP_001078309.1.5231 WP_001078309.1.52322 WP_001078309.1.52327 WP_001078309.1.52331 WP_001078309.1.52340 WP_001078309.1.52343 WP_001078309.1.52377 WP_001078309.1.52396 WP_001078309.1.52423 WP_001078309.1.52427 WP_001078309.1.52436 WP_001078309.1.52440 WP_001078309.1.52442 WP_001078309.1.52452 WP_001078309.1.52463 WP_001078309.1.52464 WP_001078309.1.52474 WP_001078309.1.5251 WP_001078309.1.52511 WP_001078309.1.52518 WP_001078309.1.52548 WP_001078309.1.52595 WP_001078309.1.52602 WP_001078309.1.52605 WP_001078309.1.52622 WP_001078309.1.52623 WP_001078309.1.52624 WP_001078309.1.52633 WP_001078309.1.52645 WP_001078309.1.52660 WP_001078309.1.52670 WP_001078309.1.52687 WP_001078309.1.52699 WP_001078309.1.52715 WP_001078309.1.52722 WP_001078309.1.52751 WP_001078309.1.52754 WP_001078309.1.52828 WP_001078309.1.52830 WP_001078309.1.52836 WP_001078309.1.52848 WP_001078309.1.52865 WP_001078309.1.52877 WP_001078309.1.52886 WP_001078309.1.52889 WP_001078309.1.52893 WP_001078309.1.52900 WP_001078309.1.52941 WP_001078309.1.52947 WP_001078309.1.52965 WP_001078309.1.52983 WP_001078309.1.52984 WP_001078309.1.52992 WP_001078309.1.53002 WP_001078309.1.53022 WP_001078309.1.5304 WP_001078309.1.53050 WP_001078309.1.53057 WP_001078309.1.53060 WP_001078309.1.53069 WP_001078309.1.53071 WP_001078309.1.53109 WP_001078309.1.53140 WP_001078309.1.53153 WP_001078309.1.53178 WP_001078309.1.53189 WP_001078309.1.5319 WP_001078309.1.53209 WP_001078309.1.5321 WP_001078309.1.5323 WP_001078309.1.53245 WP_001078309.1.53260 WP_001078309.1.53285 WP_001078309.1.53312 WP_001078309.1.53317 WP_001078309.1.53319 WP_001078309.1.53323 WP_001078309.1.53352 WP_001078309.1.5336 WP_001078309.1.53363 WP_001078309.1.53366 WP_001078309.1.53372 WP_001078309.1.53373 WP_001078309.1.53379 WP_001078309.1.53383 WP_001078309.1.53387 WP_001078309.1.53394 WP_001078309.1.53403 WP_001078309.1.53408 WP_001078309.1.53418 WP_001078309.1.53432 WP_001078309.1.53433 WP_001078309.1.53444 WP_001078309.1.53452 WP_001078309.1.53462 WP_001078309.1.53467 WP_001078309.1.5347 WP_001078309.1.53488 WP_001078309.1.53503 WP_001078309.1.53521 WP_001078309.1.53532 WP_001078309.1.53577 WP_001078309.1.53648 WP_001078309.1.53671 WP_001078309.1.53691 WP_001078309.1.53758 WP_001078309.1.53759 WP_001078309.1.53766 WP_001078309.1.53774 WP_001078309.1.53799 WP_001078309.1.5382 WP_001078309.1.53827 WP_001078309.1.53835 WP_001078309.1.53886 WP_001078309.1.53889 WP_001078309.1.53911 WP_001078309.1.53915 WP_001078309.1.53924 WP_001078309.1.53926 WP_001078309.1.53934 WP_001078309.1.53969 WP_001078309.1.53999 WP_001078309.1.54022 WP_001078309.1.54029 WP_001078309.1.54048 WP_001078309.1.54049 WP_001078309.1.54074 WP_001078309.1.54086 WP_001078309.1.54105 WP_001078309.1.54109 WP_001078309.1.54147 WP_001078309.1.54161 WP_001078309.1.54199 WP_001078309.1.54229 WP_001078309.1.54237 WP_001078309.1.54246 WP_001078309.1.54253 WP_001078309.1.54282 WP_001078309.1.54290 WP_001078309.1.54297 WP_001078309.1.54299 WP_001078309.1.54332 WP_001078309.1.54373 WP_001078309.1.54395 WP_001078309.1.544 WP_001078309.1.54404 WP_001078309.1.54413 WP_001078309.1.54426 WP_001078309.1.54438 WP_001078309.1.54446 WP_001078309.1.54471 WP_001078309.1.54479 WP_001078309.1.54485 WP_001078309.1.54491 WP_001078309.1.54503 WP_001078309.1.54510 WP_001078309.1.54518 WP_001078309.1.54539 WP_001078309.1.54543 WP_001078309.1.54551 WP_001078309.1.54554 WP_001078309.1.54572 WP_001078309.1.54574 WP_001078309.1.54637 WP_001078309.1.54675 WP_001078309.1.54689 WP_001078309.1.5469 WP_001078309.1.54728 WP_001078309.1.54733 WP_001078309.1.54744 WP_001078309.1.54745 WP_001078309.1.54753 WP_001078309.1.54819 WP_001078309.1.54826 WP_001078309.1.54830 WP_001078309.1.54851 WP_001078309.1.54878 WP_001078309.1.54895 WP_001078309.1.54929 WP_001078309.1.54931 WP_001078309.1.54955 WP_001078309.1.54967 WP_001078309.1.54990 WP_001078309.1.54995 WP_001078309.1.5500 WP_001078309.1.55004 WP_001078309.1.55014 WP_001078309.1.55058 WP_001078309.1.55082 WP_001078309.1.55084 WP_001078309.1.55095 WP_001078309.1.55100 WP_001078309.1.55139 WP_001078309.1.5518 WP_001078309.1.5519 WP_001078309.1.55192 WP_001078309.1.552 WP_001078309.1.55214 WP_001078309.1.55220 WP_001078309.1.55239 WP_001078309.1.55271 WP_001078309.1.55272 WP_001078309.1.55274 WP_001078309.1.55301 WP_001078309.1.55306 WP_001078309.1.55309 WP_001078309.1.55327 WP_001078309.1.55336 WP_001078309.1.55353 WP_001078309.1.5536 WP_001078309.1.55367 WP_001078309.1.55369 WP_001078309.1.55403 WP_001078309.1.55405 WP_001078309.1.55419 WP_001078309.1.55421 WP_001078309.1.55442 WP_001078309.1.55495 WP_001078309.1.5550 WP_001078309.1.55508 WP_001078309.1.55527 WP_001078309.1.55535 WP_001078309.1.55538 WP_001078309.1.5554 WP_001078309.1.55544 WP_001078309.1.55558 WP_001078309.1.5556 WP_001078309.1.55573 WP_001078309.1.55583 WP_001078309.1.5559 WP_001078309.1.55603 WP_001078309.1.5562 WP_001078309.1.55628 WP_001078309.1.55637 WP_001078309.1.55653 WP_001078309.1.55657 WP_001078309.1.557 WP_001078309.1.55717 WP_001078309.1.55719 WP_001078309.1.55724 WP_001078309.1.55728 WP_001078309.1.55746 WP_001078309.1.55784 WP_001078309.1.55786 WP_001078309.1.5580 WP_001078309.1.55818 WP_001078309.1.55831 WP_001078309.1.55835 WP_001078309.1.55845 WP_001078309.1.55854 WP_001078309.1.55867 WP_001078309.1.55874 WP_001078309.1.55886 WP_001078309.1.5589 WP_001078309.1.5590 WP_001078309.1.55904 WP_001078309.1.55916 WP_001078309.1.55933 WP_001078309.1.55949 WP_001078309.1.55953 WP_001078309.1.55955 WP_001078309.1.55960 WP_001078309.1.55991 WP_001078309.1.56003 WP_001078309.1.56025 WP_001078309.1.56039 WP_001078309.1.5604 WP_001078309.1.56048 WP_001078309.1.5606 WP_001078309.1.56064 WP_001078309.1.56078 WP_001078309.1.56098 WP_001078309.1.56106 WP_001078309.1.56135 WP_001078309.1.56153 WP_001078309.1.56159 WP_001078309.1.56200 WP_001078309.1.56214 WP_001078309.1.56220 WP_001078309.1.56225 WP_001078309.1.5623 WP_001078309.1.56237 WP_001078309.1.56239 WP_001078309.1.56265 WP_001078309.1.56281 WP_001078309.1.56306 WP_001078309.1.56332 WP_001078309.1.56333 WP_001078309.1.56343 WP_001078309.1.5635 WP_001078309.1.5637 WP_001078309.1.56387 WP_001078309.1.56400 WP_001078309.1.5644 WP_001078309.1.56444 WP_001078309.1.56453 WP_001078309.1.56464 WP_001078309.1.56482 WP_001078309.1.56496 WP_001078309.1.56527 WP_001078309.1.56530 WP_001078309.1.56542 WP_001078309.1.56558 WP_001078309.1.56570 WP_001078309.1.5658 WP_001078309.1.56584 WP_001078309.1.56598 WP_001078309.1.566 WP_001078309.1.56608 WP_001078309.1.56619 WP_001078309.1.56628 WP_001078309.1.56641 WP_001078309.1.5665 WP_001078309.1.5666 WP_001078309.1.56696 WP_001078309.1.56702 WP_001078309.1.56708 WP_001078309.1.56722 WP_001078309.1.56723 WP_001078309.1.56737 WP_001078309.1.5675 WP_001078309.1.56767 WP_001078309.1.5677 WP_001078309.1.56772 WP_001078309.1.56778 WP_001078309.1.56779 WP_001078309.1.56794 WP_001078309.1.56803 WP_001078309.1.56806 WP_001078309.1.56815 WP_001078309.1.56822 WP_001078309.1.56856 WP_001078309.1.5686 WP_001078309.1.56865 WP_001078309.1.56878 WP_001078309.1.569 WP_001078309.1.56903 WP_001078309.1.56931 WP_001078309.1.56966 WP_001078309.1.56967 WP_001078309.1.56975 WP_001078309.1.56986 WP_001078309.1.57015 WP_001078309.1.57024 WP_001078309.1.57047 WP_001078309.1.5705 WP_001078309.1.57073 WP_001078309.1.57075 WP_001078309.1.57080 WP_001078309.1.57081 WP_001078309.1.57097 WP_001078309.1.57102 WP_001078309.1.57109 WP_001078309.1.57115 WP_001078309.1.57141 WP_001078309.1.57170 WP_001078309.1.57175 WP_001078309.1.5718 WP_001078309.1.57190 WP_001078309.1.57196 WP_001078309.1.57214 WP_001078309.1.57223 WP_001078309.1.57265 WP_001078309.1.57309 WP_001078309.1.57316 WP_001078309.1.57330 WP_001078309.1.57370 WP_001078309.1.57376 WP_001078309.1.57389 WP_001078309.1.57427 WP_001078309.1.57445 WP_001078309.1.57448 WP_001078309.1.57459 WP_001078309.1.57481 WP_001078309.1.5749 WP_001078309.1.57507 WP_001078309.1.5752 WP_001078309.1.57577 WP_001078309.1.57593 WP_001078309.1.57594 WP_001078309.1.57614 WP_001078309.1.5763 WP_001078309.1.57650 WP_001078309.1.57665 WP_001078309.1.57670 WP_001078309.1.57682 WP_001078309.1.57692 WP_001078309.1.57693 WP_001078309.1.5770 WP_001078309.1.57701 WP_001078309.1.57718 WP_001078309.1.57720 WP_001078309.1.57723 WP_001078309.1.57727 WP_001078309.1.57730 WP_001078309.1.57734 WP_001078309.1.57745 WP_001078309.1.57754 WP_001078309.1.57761 WP_001078309.1.57770 WP_001078309.1.57783 WP_001078309.1.57808 WP_001078309.1.57819 WP_001078309.1.57837 WP_001078309.1.57840 WP_001078309.1.57844 WP_001078309.1.57861 WP_001078309.1.57875 WP_001078309.1.57878 WP_001078309.1.57883 WP_001078309.1.57888 WP_001078309.1.579 WP_001078309.1.5791 WP_001078309.1.57910 WP_001078309.1.57915 WP_001078309.1.57943 WP_001078309.1.57944 WP_001078309.1.57952 WP_001078309.1.57962 WP_001078309.1.57974 WP_001078309.1.5799 WP_001078309.1.58005 WP_001078309.1.58006 WP_001078309.1.58014 WP_001078309.1.58016 WP_001078309.1.58017 WP_001078309.1.58035 WP_001078309.1.58042 WP_001078309.1.58049 WP_001078309.1.58050 WP_001078309.1.58051 WP_001078309.1.58074 WP_001078309.1.58106 WP_001078309.1.58116 WP_001078309.1.58122 WP_001078309.1.58127 WP_001078309.1.58148 WP_001078309.1.58158 WP_001078309.1.5816 WP_001078309.1.5817 WP_001078309.1.58175 WP_001078309.1.58185 WP_001078309.1.58198 WP_001078309.1.58212 WP_001078309.1.58241 WP_001078309.1.58242 WP_001078309.1.58246 WP_001078309.1.58277 WP_001078309.1.58317 WP_001078309.1.5832 WP_001078309.1.58321 WP_001078309.1.58325 WP_001078309.1.58350 WP_001078309.1.58352 WP_001078309.1.58353 WP_001078309.1.58364 WP_001078309.1.58366 WP_001078309.1.58373 WP_001078309.1.58388 WP_001078309.1.58392 WP_001078309.1.58395 WP_001078309.1.58413 WP_001078309.1.58419 WP_001078309.1.58421 WP_001078309.1.58430 WP_001078309.1.58435 WP_001078309.1.58473 WP_001078309.1.58481 WP_001078309.1.5849 WP_001078309.1.58495 WP_001078309.1.58497 WP_001078309.1.58504 WP_001078309.1.58508 WP_001078309.1.58512 WP_001078309.1.58521 WP_001078309.1.58530 WP_001078309.1.58538 WP_001078309.1.58549 WP_001078309.1.5857 WP_001078309.1.58571 WP_001078309.1.58592 WP_001078309.1.58598 WP_001078309.1.586 WP_001078309.1.58603 WP_001078309.1.58626 WP_001078309.1.58701 WP_001078309.1.58704 WP_001078309.1.58714 WP_001078309.1.58718 WP_001078309.1.58735 WP_001078309.1.58760 WP_001078309.1.58763 WP_001078309.1.58772 WP_001078309.1.58775 WP_001078309.1.58798 WP_001078309.1.5880 WP_001078309.1.58833 WP_001078309.1.58839 WP_001078309.1.58855 WP_001078309.1.58934 WP_001078309.1.58936 WP_001078309.1.58960 WP_001078309.1.58981 WP_001078309.1.58991 WP_001078309.1.58998 WP_001078309.1.5901 WP_001078309.1.59011 WP_001078309.1.59014 WP_001078309.1.59039 WP_001078309.1.5904 WP_001078309.1.59046 WP_001078309.1.59062 WP_001078309.1.59077 WP_001078309.1.59098 WP_001078309.1.59124 WP_001078309.1.59133 WP_001078309.1.59135 WP_001078309.1.59146 WP_001078309.1.59157 WP_001078309.1.59175 WP_001078309.1.59187 WP_001078309.1.5920 WP_001078309.1.59203 WP_001078309.1.59213 WP_001078309.1.5925 WP_001078309.1.59269 WP_001078309.1.59284 WP_001078309.1.5930 WP_001078309.1.59311 WP_001078309.1.59327 WP_001078309.1.59337 WP_001078309.1.59363 WP_001078309.1.5938 WP_001078309.1.59380 WP_001078309.1.59397 WP_001078309.1.59398 WP_001078309.1.5940 WP_001078309.1.59401 WP_001078309.1.59404 WP_001078309.1.59441 WP_001078309.1.59457 WP_001078309.1.59459 WP_001078309.1.59462 WP_001078309.1.59464 WP_001078309.1.59467 WP_001078309.1.59478 WP_001078309.1.59489 WP_001078309.1.59498 WP_001078309.1.59540 WP_001078309.1.59546 WP_001078309.1.59547 WP_001078309.1.59567 WP_001078309.1.59598 WP_001078309.1.59603 WP_001078309.1.59609 WP_001078309.1.59624 WP_001078309.1.59629 WP_001078309.1.59643 WP_001078309.1.59663 WP_001078309.1.59668 WP_001078309.1.59669 WP_001078309.1.59671 WP_001078309.1.59697 WP_001078309.1.5972 WP_001078309.1.59736 WP_001078309.1.59787 WP_001078309.1.59803 WP_001078309.1.59810 WP_001078309.1.59819 WP_001078309.1.59822 WP_001078309.1.59874 WP_001078309.1.59881 WP_001078309.1.59886 WP_001078309.1.59896 WP_001078309.1.59907 WP_001078309.1.59915 WP_001078309.1.59921 WP_001078309.1.59977 WP_001078309.1.60001 WP_001078309.1.60006 WP_001078309.1.60022 WP_001078309.1.6006 WP_001078309.1.60086 WP_001078309.1.60101 WP_001078309.1.60107 WP_001078309.1.6011 WP_001078309.1.60123 WP_001078309.1.60124 WP_001078309.1.60147 WP_001078309.1.60149 WP_001078309.1.60156 WP_001078309.1.60157 WP_001078309.1.60165 WP_001078309.1.6017 WP_001078309.1.602 WP_001078309.1.60201 WP_001078309.1.60227 WP_001078309.1.60251 WP_001078309.1.60259 WP_001078309.1.60280 WP_001078309.1.60289 WP_001078309.1.60302 WP_001078309.1.60307 WP_001078309.1.6034 WP_001078309.1.60345 WP_001078309.1.60353 WP_001078309.1.60360 WP_001078309.1.60368 WP_001078309.1.60382 WP_001078309.1.60414 WP_001078309.1.60431 WP_001078309.1.60434 WP_001078309.1.6045 WP_001078309.1.60462 WP_001078309.1.60473 WP_001078309.1.60492 WP_001078309.1.60493 WP_001078309.1.60515 WP_001078309.1.60530 WP_001078309.1.60547 WP_001078309.1.60551 WP_001078309.1.60585 WP_001078309.1.60594 WP_001078309.1.60595 WP_001078309.1.60636 WP_001078309.1.60641 WP_001078309.1.60675 WP_001078309.1.60677 WP_001078309.1.60690 WP_001078309.1.60696 WP_001078309.1.60704 WP_001078309.1.60734 WP_001078309.1.60750 WP_001078309.1.60751 WP_001078309.1.60758 WP_001078309.1.60759 WP_001078309.1.60765 WP_001078309.1.60778 WP_001078309.1.60787 WP_001078309.1.60813 WP_001078309.1.60820 WP_001078309.1.60845 WP_001078309.1.6085 WP_001078309.1.60869 WP_001078309.1.60888 WP_001078309.1.60898 WP_001078309.1.60912 WP_001078309.1.60917 WP_001078309.1.60923 WP_001078309.1.60939 WP_001078309.1.60943 WP_001078309.1.60946 WP_001078309.1.60948 WP_001078309.1.60949 WP_001078309.1.60965 WP_001078309.1.60981 WP_001078309.1.60982 WP_001078309.1.60991 WP_001078309.1.61009 WP_001078309.1.61013 WP_001078309.1.61023 WP_001078309.1.61026 WP_001078309.1.61029 WP_001078309.1.61030 WP_001078309.1.61031 WP_001078309.1.61077 WP_001078309.1.61082 WP_001078309.1.61107 WP_001078309.1.61115 WP_001078309.1.61119 WP_001078309.1.61139 WP_001078309.1.61152 WP_001078309.1.61153 WP_001078309.1.6118 WP_001078309.1.61187 WP_001078309.1.61188 WP_001078309.1.61189 WP_001078309.1.6119 WP_001078309.1.61215 WP_001078309.1.6123 WP_001078309.1.61257 WP_001078309.1.61261 WP_001078309.1.61263 WP_001078309.1.61271 WP_001078309.1.61277 WP_001078309.1.61286 WP_001078309.1.61289 WP_001078309.1.61313 WP_001078309.1.61316 WP_001078309.1.61324 WP_001078309.1.61327 WP_001078309.1.61339 WP_001078309.1.61353 WP_001078309.1.6136 WP_001078309.1.61375 WP_001078309.1.61393 WP_001078309.1.61394 WP_001078309.1.61408 WP_001078309.1.61413 WP_001078309.1.61421 WP_001078309.1.61430 WP_001078309.1.61439 WP_001078309.1.61440 WP_001078309.1.61534 WP_001078309.1.61547 WP_001078309.1.61555 WP_001078309.1.61564 WP_001078309.1.61585 WP_001078309.1.61591 WP_001078309.1.61597 WP_001078309.1.61615 WP_001078309.1.61639 WP_001078309.1.61641 WP_001078309.1.6166 WP_001078309.1.6168 WP_001078309.1.61687 WP_001078309.1.6170 WP_001078309.1.61705 WP_001078309.1.61747 WP_001078309.1.61749 WP_001078309.1.61784 WP_001078309.1.61800 WP_001078309.1.61802 WP_001078309.1.61831 WP_001078309.1.61838 WP_001078309.1.61864 WP_001078309.1.6189 WP_001078309.1.61897 WP_001078309.1.61899 WP_001078309.1.619 WP_001078309.1.61903 WP_001078309.1.61910 WP_001078309.1.61921 WP_001078309.1.61936 WP_001078309.1.61970 WP_001078309.1.61975 WP_001078309.1.61978 WP_001078309.1.62002 WP_001078309.1.6201 WP_001078309.1.62028 WP_001078309.1.62030 WP_001078309.1.62069 WP_001078309.1.62071 WP_001078309.1.6208 WP_001078309.1.62084 WP_001078309.1.62085 WP_001078309.1.62088 WP_001078309.1.62093 WP_001078309.1.62096 WP_001078309.1.62140 WP_001078309.1.62160 WP_001078309.1.62164 WP_001078309.1.62229 WP_001078309.1.62247 WP_001078309.1.62253 WP_001078309.1.62254 WP_001078309.1.62265 WP_001078309.1.62318 WP_001078309.1.6234 WP_001078309.1.62346 WP_001078309.1.62352 WP_001078309.1.62367 WP_001078309.1.62382 WP_001078309.1.62383 WP_001078309.1.62398 WP_001078309.1.62409 WP_001078309.1.62414 WP_001078309.1.62416 WP_001078309.1.62429 WP_001078309.1.62437 WP_001078309.1.62453 WP_001078309.1.62459 WP_001078309.1.62474 WP_001078309.1.62482 WP_001078309.1.62492 WP_001078309.1.62496 WP_001078309.1.6250 WP_001078309.1.62537 WP_001078309.1.62539 WP_001078309.1.62553 WP_001078309.1.62575 WP_001078309.1.62602 WP_001078309.1.62608 WP_001078309.1.62621 WP_001078309.1.62625 WP_001078309.1.62630 WP_001078309.1.62653 WP_001078309.1.62671 WP_001078309.1.62674 WP_001078309.1.6268 WP_001078309.1.62684 WP_001078309.1.62685 WP_001078309.1.62723 WP_001078309.1.62740 WP_001078309.1.62756 WP_001078309.1.62764 WP_001078309.1.62771 WP_001078309.1.62781 WP_001078309.1.62796 WP_001078309.1.62808 WP_001078309.1.62822 WP_001078309.1.62824 WP_001078309.1.62829 WP_001078309.1.62831 WP_001078309.1.62842 WP_001078309.1.62863 WP_001078309.1.62878 WP_001078309.1.62880 WP_001078309.1.62927 WP_001078309.1.62956 WP_001078309.1.62970 WP_001078309.1.62974 WP_001078309.1.6298 WP_001078309.1.62998 WP_001078309.1.63003 WP_001078309.1.63004 WP_001078309.1.63011 WP_001078309.1.63027 WP_001078309.1.63040 WP_001078309.1.63047 WP_001078309.1.63050 WP_001078309.1.63051 WP_001078309.1.63052 WP_001078309.1.63062 WP_001078309.1.63068 WP_001078309.1.63070 WP_001078309.1.63083 WP_001078309.1.63085 WP_001078309.1.631 WP_001078309.1.63120 WP_001078309.1.63131 WP_001078309.1.63132 WP_001078309.1.63139 WP_001078309.1.63140 WP_001078309.1.63142 WP_001078309.1.63143 WP_001078309.1.63162 WP_001078309.1.63170 WP_001078309.1.63182 WP_001078309.1.63190 WP_001078309.1.63195 WP_001078309.1.63215 WP_001078309.1.63220 WP_001078309.1.63228 WP_001078309.1.63233 WP_001078309.1.63244 WP_001078309.1.63266 WP_001078309.1.63273 WP_001078309.1.63279 WP_001078309.1.63280 WP_001078309.1.63289 WP_001078309.1.63296 WP_001078309.1.63304 WP_001078309.1.63307 WP_001078309.1.63313 WP_001078309.1.63319 WP_001078309.1.63322 WP_001078309.1.63324 WP_001078309.1.63333 WP_001078309.1.63335 WP_001078309.1.63337 WP_001078309.1.63341 WP_001078309.1.63364 WP_001078309.1.63365 WP_001078309.1.63383 WP_001078309.1.634 WP_001078309.1.63406 WP_001078309.1.63411 WP_001078309.1.63421 WP_001078309.1.63441 WP_001078309.1.63460 WP_001078309.1.63469 WP_001078309.1.63471 WP_001078309.1.63510 WP_001078309.1.63527 WP_001078309.1.63565 WP_001078309.1.63589 WP_001078309.1.63617 WP_001078309.1.63673 WP_001078309.1.63678 WP_001078309.1.63693 WP_001078309.1.63705 WP_001078309.1.63726 WP_001078309.1.63729 WP_001078309.1.6374 WP_001078309.1.63751 WP_001078309.1.63759 WP_001078309.1.63760 WP_001078309.1.63774 WP_001078309.1.6378 WP_001078309.1.63828 WP_001078309.1.63847 WP_001078309.1.63874 WP_001078309.1.63878 WP_001078309.1.6388 WP_001078309.1.63894 WP_001078309.1.63895 WP_001078309.1.63907 WP_001078309.1.63910 WP_001078309.1.63923 WP_001078309.1.63937 WP_001078309.1.63947 WP_001078309.1.63975 WP_001078309.1.63978 WP_001078309.1.63987 WP_001078309.1.64012 WP_001078309.1.6403 WP_001078309.1.6408 WP_001078309.1.64094 WP_001078309.1.64105 WP_001078309.1.64108 WP_001078309.1.6412 WP_001078309.1.64127 WP_001078309.1.64192 WP_001078309.1.642 WP_001078309.1.64207 WP_001078309.1.64230 WP_001078309.1.64234 WP_001078309.1.64250 WP_001078309.1.64251 WP_001078309.1.64279 WP_001078309.1.64303 WP_001078309.1.64334 WP_001078309.1.64351 WP_001078309.1.64367 WP_001078309.1.64368 WP_001078309.1.6438 WP_001078309.1.64396 WP_001078309.1.64397 WP_001078309.1.64400 WP_001078309.1.64440 WP_001078309.1.64456 WP_001078309.1.64457 WP_001078309.1.64473 WP_001078309.1.64525 WP_001078309.1.64549 WP_001078309.1.64565 WP_001078309.1.64583 WP_001078309.1.6459 WP_001078309.1.64598 WP_001078309.1.6462 WP_001078309.1.64628 WP_001078309.1.64630 WP_001078309.1.64631 WP_001078309.1.64643 WP_001078309.1.64665 WP_001078309.1.64677 WP_001078309.1.64686 WP_001078309.1.64720 WP_001078309.1.64765 WP_001078309.1.6479 WP_001078309.1.64811 WP_001078309.1.64845 WP_001078309.1.64858 WP_001078309.1.64860 WP_001078309.1.64873 WP_001078309.1.64879 WP_001078309.1.6488 WP_001078309.1.64893 WP_001078309.1.64896 WP_001078309.1.64897 WP_001078309.1.64899 WP_001078309.1.64928 WP_001078309.1.64935 WP_001078309.1.64951 WP_001078309.1.64956 WP_001078309.1.64961 WP_001078309.1.64988 WP_001078309.1.64996 WP_001078309.1.64998 WP_001078309.1.65025 WP_001078309.1.65033 WP_001078309.1.65038 WP_001078309.1.65044 WP_001078309.1.65046 WP_001078309.1.65076 WP_001078309.1.65082 WP_001078309.1.65125 WP_001078309.1.65132 WP_001078309.1.65153 WP_001078309.1.65156 WP_001078309.1.65158 WP_001078309.1.65180 WP_001078309.1.65193 WP_001078309.1.65203 WP_001078309.1.65214 WP_001078309.1.65217 WP_001078309.1.65233 WP_001078309.1.65243 WP_001078309.1.65259 WP_001078309.1.65264 WP_001078309.1.6531 WP_001078309.1.65317 WP_001078309.1.65346 WP_001078309.1.65358 WP_001078309.1.65361 WP_001078309.1.65367 WP_001078309.1.65387 WP_001078309.1.65406 WP_001078309.1.65407 WP_001078309.1.65419 WP_001078309.1.65423 WP_001078309.1.65432 WP_001078309.1.6544 WP_001078309.1.65443 WP_001078309.1.65448 WP_001078309.1.65451 WP_001078309.1.6547 WP_001078309.1.65470 WP_001078309.1.65504 WP_001078309.1.6551 WP_001078309.1.65512 WP_001078309.1.65520 WP_001078309.1.65541 WP_001078309.1.65544 WP_001078309.1.65555 WP_001078309.1.65562 WP_001078309.1.65585 WP_001078309.1.6559 WP_001078309.1.65600 WP_001078309.1.65616 WP_001078309.1.65629 WP_001078309.1.65643 WP_001078309.1.65653 WP_001078309.1.65656 WP_001078309.1.65663 WP_001078309.1.65675 WP_001078309.1.6568 WP_001078309.1.65689 WP_001078309.1.65693 WP_001078309.1.65700 WP_001078309.1.65703 WP_001078309.1.65705 WP_001078309.1.65713 WP_001078309.1.65717 WP_001078309.1.65734 WP_001078309.1.65750 WP_001078309.1.65752 WP_001078309.1.65769 WP_001078309.1.65808 WP_001078309.1.65809 WP_001078309.1.65842 WP_001078309.1.6585 WP_001078309.1.65856 WP_001078309.1.65870 WP_001078309.1.65879 WP_001078309.1.65886 WP_001078309.1.65892 WP_001078309.1.65922 WP_001078309.1.65930 WP_001078309.1.65931 WP_001078309.1.65935 WP_001078309.1.65946 WP_001078309.1.65947 WP_001078309.1.65948 WP_001078309.1.65965 WP_001078309.1.65986 WP_001078309.1.66009 WP_001078309.1.6603 WP_001078309.1.66035 WP_001078309.1.66054 WP_001078309.1.66056 WP_001078309.1.66069 WP_001078309.1.66073 WP_001078309.1.661 WP_001078309.1.6612 WP_001078309.1.66120 WP_001078309.1.66130 WP_001078309.1.66133 WP_001078309.1.66144 WP_001078309.1.66175 WP_001078309.1.66262 WP_001078309.1.66265 WP_001078309.1.66281 WP_001078309.1.66287 WP_001078309.1.66298 WP_001078309.1.66302 WP_001078309.1.6632 WP_001078309.1.66322 WP_001078309.1.66366 WP_001078309.1.66369 WP_001078309.1.66433 WP_001078309.1.66453 WP_001078309.1.66482 WP_001078309.1.66505 WP_001078309.1.66513 WP_001078309.1.66519 WP_001078309.1.66542 WP_001078309.1.66554 WP_001078309.1.66556 WP_001078309.1.66564 WP_001078309.1.66576 WP_001078309.1.66588 WP_001078309.1.66598 WP_001078309.1.66601 WP_001078309.1.66606 WP_001078309.1.66611 WP_001078309.1.66614 WP_001078309.1.6662 WP_001078309.1.66628 WP_001078309.1.66655 WP_001078309.1.66664 WP_001078309.1.66677 WP_001078309.1.66705 WP_001078309.1.66711 WP_001078309.1.66712 WP_001078309.1.66726 WP_001078309.1.6674 WP_001078309.1.66756 WP_001078309.1.66765 WP_001078309.1.66766 WP_001078309.1.66786 WP_001078309.1.66803 WP_001078309.1.66816 WP_001078309.1.66818 WP_001078309.1.6684 WP_001078309.1.66879 WP_001078309.1.6688 WP_001078309.1.66904 WP_001078309.1.66938 WP_001078309.1.66969 WP_001078309.1.66979 WP_001078309.1.66996 WP_001078309.1.6700 WP_001078309.1.67006 WP_001078309.1.67012 WP_001078309.1.67014 WP_001078309.1.67063 WP_001078309.1.67067 WP_001078309.1.67072 WP_001078309.1.67090 WP_001078309.1.67112 WP_001078309.1.67113 WP_001078309.1.67135 WP_001078309.1.67147 WP_001078309.1.67155 WP_001078309.1.67160 WP_001078309.1.67191 WP_001078309.1.67204 WP_001078309.1.67212 WP_001078309.1.6722 WP_001078309.1.67238 WP_001078309.1.67251 WP_001078309.1.67259 WP_001078309.1.6726 WP_001078309.1.67266 WP_001078309.1.67286 WP_001078309.1.67294 WP_001078309.1.67296 WP_001078309.1.67297 WP_001078309.1.67312 WP_001078309.1.67328 WP_001078309.1.67329 WP_001078309.1.67333 WP_001078309.1.67379 WP_001078309.1.67384 WP_001078309.1.67386 WP_001078309.1.6740 WP_001078309.1.67414 WP_001078309.1.67418 WP_001078309.1.67420 WP_001078309.1.67425 WP_001078309.1.67457 WP_001078309.1.67460 WP_001078309.1.67463 WP_001078309.1.67480 WP_001078309.1.67505 WP_001078309.1.67507 WP_001078309.1.67513 WP_001078309.1.67520 WP_001078309.1.67521 WP_001078309.1.67540 WP_001078309.1.67554 WP_001078309.1.67571 WP_001078309.1.67572 WP_001078309.1.67609 WP_001078309.1.67612 WP_001078309.1.67618 WP_001078309.1.67621 WP_001078309.1.67632 WP_001078309.1.67644 WP_001078309.1.67651 WP_001078309.1.67652 WP_001078309.1.67653 WP_001078309.1.67691 WP_001078309.1.67703 WP_001078309.1.67712 WP_001078309.1.67713 WP_001078309.1.67722 WP_001078309.1.67752 WP_001078309.1.67754 WP_001078309.1.67762 WP_001078309.1.67767 WP_001078309.1.67806 WP_001078309.1.67834 WP_001078309.1.6786 WP_001078309.1.67864 WP_001078309.1.67865 WP_001078309.1.67867 WP_001078309.1.67880 WP_001078309.1.67889 WP_001078309.1.67900 WP_001078309.1.67925 WP_001078309.1.67941 WP_001078309.1.67986 WP_001078309.1.67991 WP_001078309.1.68001 WP_001078309.1.68033 WP_001078309.1.68054 WP_001078309.1.68066 WP_001078309.1.68101 WP_001078309.1.68102 WP_001078309.1.6811 WP_001078309.1.68111 WP_001078309.1.68134 WP_001078309.1.68141 WP_001078309.1.68152 WP_001078309.1.68160 WP_001078309.1.68161 WP_001078309.1.68199 WP_001078309.1.68202 WP_001078309.1.68219 WP_001078309.1.68221 WP_001078309.1.68223 WP_001078309.1.6824 WP_001078309.1.68261 WP_001078309.1.68268 WP_001078309.1.68286 WP_001078309.1.68295 WP_001078309.1.68296 WP_001078309.1.68299 WP_001078309.1.6830 WP_001078309.1.68307 WP_001078309.1.6834 WP_001078309.1.68343 WP_001078309.1.68351 WP_001078309.1.68355 WP_001078309.1.68366 WP_001078309.1.68367 WP_001078309.1.6839 WP_001078309.1.68397 WP_001078309.1.68398 WP_001078309.1.68399 WP_001078309.1.68404 WP_001078309.1.68416 WP_001078309.1.68425 WP_001078309.1.68466 WP_001078309.1.68476 WP_001078309.1.68479 WP_001078309.1.68483 WP_001078309.1.68489 WP_001078309.1.68504 WP_001078309.1.68505 WP_001078309.1.68512 WP_001078309.1.68522 WP_001078309.1.68542 WP_001078309.1.68548 WP_001078309.1.68565 WP_001078309.1.68575 WP_001078309.1.686 WP_001078309.1.68636 WP_001078309.1.68650 WP_001078309.1.68657 WP_001078309.1.68681 WP_001078309.1.68683 WP_001078309.1.68699 WP_001078309.1.68703 WP_001078309.1.68716 WP_001078309.1.68728 WP_001078309.1.68737 WP_001078309.1.68741 WP_001078309.1.68743 WP_001078309.1.68775 WP_001078309.1.68813 WP_001078309.1.68831 WP_001078309.1.68854 WP_001078309.1.68864 WP_001078309.1.68875 WP_001078309.1.68878 WP_001078309.1.68883 WP_001078309.1.68917 WP_001078309.1.68943 WP_001078309.1.68944 WP_001078309.1.68987 WP_001078309.1.68988 WP_001078309.1.68998 WP_001078309.1.69012 WP_001078309.1.69045 WP_001078309.1.69071 WP_001078309.1.69078 WP_001078309.1.69087 WP_001078309.1.69089 WP_001078309.1.691 WP_001078309.1.69105 WP_001078309.1.69110 WP_001078309.1.69111 WP_001078309.1.69120 WP_001078309.1.69125 WP_001078309.1.69147 WP_001078309.1.6915 WP_001078309.1.6917 WP_001078309.1.69179 WP_001078309.1.69191 WP_001078309.1.69198 WP_001078309.1.69213 WP_001078309.1.69219 WP_001078309.1.69222 WP_001078309.1.69232 WP_001078309.1.69237 WP_001078309.1.69251 WP_001078309.1.69266 WP_001078309.1.69280 WP_001078309.1.69314 WP_001078309.1.69349 WP_001078309.1.69361 WP_001078309.1.69366 WP_001078309.1.69378 WP_001078309.1.69394 WP_001078309.1.69395 WP_001078309.1.69409 WP_001078309.1.69415 WP_001078309.1.69434 WP_001078309.1.69437 WP_001078309.1.69446 WP_001078309.1.69475 WP_001078309.1.69476 WP_001078309.1.69477 WP_001078309.1.69480 WP_001078309.1.69484 WP_001078309.1.69490 WP_001078309.1.695 WP_001078309.1.6953 WP_001078309.1.69546 WP_001078309.1.69552 WP_001078309.1.69559 WP_001078309.1.69563 WP_001078309.1.69598 WP_001078309.1.69622 WP_001078309.1.69679 WP_001078309.1.69683 WP_001078309.1.69685 WP_001078309.1.69718 WP_001078309.1.69724 WP_001078309.1.69734 WP_001078309.1.6980 WP_001078309.1.69820 WP_001078309.1.69823 WP_001078309.1.69830 WP_001078309.1.69842 WP_001078309.1.69877 WP_001078309.1.69878 WP_001078309.1.69882 WP_001078309.1.699 WP_001078309.1.69902 WP_001078309.1.69921 WP_001078309.1.69934 WP_001078309.1.69980 WP_001078309.1.69987 WP_001078309.1.69995 WP_001078309.1.70024 WP_001078309.1.70048 WP_001078309.1.70059 WP_001078309.1.70089 WP_001078309.1.70094 WP_001078309.1.70105 WP_001078309.1.7012 WP_001078309.1.70133 WP_001078309.1.70161 WP_001078309.1.70210 WP_001078309.1.70220 WP_001078309.1.70225 WP_001078309.1.70228 WP_001078309.1.7024 WP_001078309.1.70253 WP_001078309.1.70273 WP_001078309.1.70294 WP_001078309.1.703 WP_001078309.1.7030 WP_001078309.1.70311 WP_001078309.1.70313 WP_001078309.1.70334 WP_001078309.1.70338 WP_001078309.1.7034 WP_001078309.1.70344 WP_001078309.1.70349 WP_001078309.1.70353 WP_001078309.1.70361 WP_001078309.1.70389 WP_001078309.1.70413 WP_001078309.1.7043 WP_001078309.1.70438 WP_001078309.1.70441 WP_001078309.1.70448 WP_001078309.1.70451 WP_001078309.1.70459 WP_001078309.1.7046 WP_001078309.1.70462 WP_001078309.1.70487 WP_001078309.1.70495 WP_001078309.1.70527 WP_001078309.1.7053 WP_001078309.1.70546 WP_001078309.1.70554 WP_001078309.1.70558 WP_001078309.1.70564 WP_001078309.1.70572 WP_001078309.1.706 WP_001078309.1.7061 WP_001078309.1.70611 WP_001078309.1.70635 WP_001078309.1.7064 WP_001078309.1.70641 WP_001078309.1.70651 WP_001078309.1.70664 WP_001078309.1.7067 WP_001078309.1.707 WP_001078309.1.7071 WP_001078309.1.70721 WP_001078309.1.7073 WP_001078309.1.70763 WP_001078309.1.70790 WP_001078309.1.70791 WP_001078309.1.70807 WP_001078309.1.70808 WP_001078309.1.70818 WP_001078309.1.70823 WP_001078309.1.70829 WP_001078309.1.70835 WP_001078309.1.70843 WP_001078309.1.70855 WP_001078309.1.7089 WP_001078309.1.70909 WP_001078309.1.70917 WP_001078309.1.70924 WP_001078309.1.70926 WP_001078309.1.70930 WP_001078309.1.70939 WP_001078309.1.70943 WP_001078309.1.710 WP_001078309.1.71016 WP_001078309.1.71043 WP_001078309.1.7105 WP_001078309.1.71058 WP_001078309.1.71059 WP_001078309.1.71073 WP_001078309.1.7109 WP_001078309.1.711 WP_001078309.1.71130 WP_001078309.1.71143 WP_001078309.1.71180 WP_001078309.1.7119 WP_001078309.1.71196 WP_001078309.1.7120 WP_001078309.1.71208 WP_001078309.1.71231 WP_001078309.1.71236 WP_001078309.1.7125 WP_001078309.1.71256 WP_001078309.1.71257 WP_001078309.1.71267 WP_001078309.1.71295 WP_001078309.1.71298 WP_001078309.1.71313 WP_001078309.1.71316 WP_001078309.1.71325 WP_001078309.1.71332 WP_001078309.1.71345 WP_001078309.1.71351 WP_001078309.1.71359 WP_001078309.1.71410 WP_001078309.1.71419 WP_001078309.1.71431 WP_001078309.1.71463 WP_001078309.1.71467 WP_001078309.1.71475 WP_001078309.1.7150 WP_001078309.1.71519 WP_001078309.1.71521 WP_001078309.1.71529 WP_001078309.1.71543 WP_001078309.1.71572 WP_001078309.1.71575 WP_001078309.1.71590 WP_001078309.1.71596 WP_001078309.1.71602 WP_001078309.1.7161 WP_001078309.1.7164 WP_001078309.1.71644 WP_001078309.1.71662 WP_001078309.1.71676 WP_001078309.1.71707 WP_001078309.1.71715 WP_001078309.1.71721 WP_001078309.1.71735 WP_001078309.1.71737 WP_001078309.1.71739 WP_001078309.1.71741 WP_001078309.1.71772 WP_001078309.1.71780 WP_001078309.1.71788 WP_001078309.1.7179 WP_001078309.1.71859 WP_001078309.1.71861 WP_001078309.1.71863 WP_001078309.1.71877 WP_001078309.1.71888 WP_001078309.1.71892 WP_001078309.1.71899 WP_001078309.1.71910 WP_001078309.1.71925 WP_001078309.1.7193 WP_001078309.1.71949 WP_001078309.1.71978 WP_001078309.1.7198 WP_001078309.1.71989 WP_001078309.1.72002 WP_001078309.1.72018 WP_001078309.1.72026 WP_001078309.1.72031 WP_001078309.1.72035 WP_001078309.1.72067 WP_001078309.1.72085 WP_001078309.1.72089 WP_001078309.1.72099 WP_001078309.1.72102 WP_001078309.1.72112 WP_001078309.1.72148 WP_001078309.1.72169 WP_001078309.1.72176 WP_001078309.1.722 WP_001078309.1.72204 WP_001078309.1.72205 WP_001078309.1.72224 WP_001078309.1.72271 WP_001078309.1.72285 WP_001078309.1.72306 WP_001078309.1.72315 WP_001078309.1.72330 WP_001078309.1.72340 WP_001078309.1.72347 WP_001078309.1.7236 WP_001078309.1.72363 WP_001078309.1.72366 WP_001078309.1.72371 WP_001078309.1.7242 WP_001078309.1.72433 WP_001078309.1.72446 WP_001078309.1.72453 WP_001078309.1.72465 WP_001078309.1.72496 WP_001078309.1.72497 WP_001078309.1.7254 WP_001078309.1.72547 WP_001078309.1.72564 WP_001078309.1.7258 WP_001078309.1.7260 WP_001078309.1.72626 WP_001078309.1.72649 WP_001078309.1.72654 WP_001078309.1.72666 WP_001078309.1.72708 WP_001078309.1.72719 WP_001078309.1.72750 WP_001078309.1.72753 WP_001078309.1.72762 WP_001078309.1.7278 WP_001078309.1.72787 WP_001078309.1.72832 WP_001078309.1.72834 WP_001078309.1.72835 WP_001078309.1.72881 WP_001078309.1.72903 WP_001078309.1.72904 WP_001078309.1.7292 WP_001078309.1.72930 WP_001078309.1.72935 WP_001078309.1.72945 WP_001078309.1.72961 WP_001078309.1.72965 WP_001078309.1.72991 WP_001078309.1.73002 WP_001078309.1.73004 WP_001078309.1.73017 WP_001078309.1.73019 WP_001078309.1.73021 WP_001078309.1.73022 WP_001078309.1.73037 WP_001078309.1.73046 WP_001078309.1.73074 WP_001078309.1.73087 WP_001078309.1.73121 WP_001078309.1.73122 WP_001078309.1.73132 WP_001078309.1.73140 WP_001078309.1.73190 WP_001078309.1.73191 WP_001078309.1.73195 WP_001078309.1.73201 WP_001078309.1.73211 WP_001078309.1.73240 WP_001078309.1.73241 WP_001078309.1.73246 WP_001078309.1.7326 WP_001078309.1.73264 WP_001078309.1.73265 WP_001078309.1.73286 WP_001078309.1.73312 WP_001078309.1.73386 WP_001078309.1.73401 WP_001078309.1.73402 WP_001078309.1.73420 WP_001078309.1.73450 WP_001078309.1.73456 WP_001078309.1.73464 WP_001078309.1.73467 WP_001078309.1.73501 WP_001078309.1.73513 WP_001078309.1.73526 WP_001078309.1.73539 WP_001078309.1.73571 WP_001078309.1.73591 WP_001078309.1.736 WP_001078309.1.7360 WP_001078309.1.73610 WP_001078309.1.73639 WP_001078309.1.73640 WP_001078309.1.7365 WP_001078309.1.73674 WP_001078309.1.73685 WP_001078309.1.73693 WP_001078309.1.73694 WP_001078309.1.73733 WP_001078309.1.73735 WP_001078309.1.73736 WP_001078309.1.73740 WP_001078309.1.73759 WP_001078309.1.73786 WP_001078309.1.73789 WP_001078309.1.7380 WP_001078309.1.73834 WP_001078309.1.73853 WP_001078309.1.73858 WP_001078309.1.73868 WP_001078309.1.73880 WP_001078309.1.73885 WP_001078309.1.73900 WP_001078309.1.73902 WP_001078309.1.73910 WP_001078309.1.73920 WP_001078309.1.73921 WP_001078309.1.73940 WP_001078309.1.73949 WP_001078309.1.73961 WP_001078309.1.73969 WP_001078309.1.73971 WP_001078309.1.73976 WP_001078309.1.73983 WP_001078309.1.74004 WP_001078309.1.74006 WP_001078309.1.7401 WP_001078309.1.74010 WP_001078309.1.74013 WP_001078309.1.74027 WP_001078309.1.7406 WP_001078309.1.74073 WP_001078309.1.74081 WP_001078309.1.74085 WP_001078309.1.74088 WP_001078309.1.74138 WP_001078309.1.74155 WP_001078309.1.74157 WP_001078309.1.74158 WP_001078309.1.74161 WP_001078309.1.74172 WP_001078309.1.74173 WP_001078309.1.7418 WP_001078309.1.74183 WP_001078309.1.74187 WP_001078309.1.74201 WP_001078309.1.74216 WP_001078309.1.74221 WP_001078309.1.74234 WP_001078309.1.74237 WP_001078309.1.74242 WP_001078309.1.74257 WP_001078309.1.7427 WP_001078309.1.74273 WP_001078309.1.7428 WP_001078309.1.74284 WP_001078309.1.74295 WP_001078309.1.74327 WP_001078309.1.74338 WP_001078309.1.7434 WP_001078309.1.74353 WP_001078309.1.74356 WP_001078309.1.74380 WP_001078309.1.74390 WP_001078309.1.74429 WP_001078309.1.74456 WP_001078309.1.74457 WP_001078309.1.74468 WP_001078309.1.74474 WP_001078309.1.74486 WP_001078309.1.74497 WP_001078309.1.74510 WP_001078309.1.74533 WP_001078309.1.74556 WP_001078309.1.7457 WP_001078309.1.74576 WP_001078309.1.74587 WP_001078309.1.74590 WP_001078309.1.74610 WP_001078309.1.74638 WP_001078309.1.74645 WP_001078309.1.74676 WP_001078309.1.74681 WP_001078309.1.74693 WP_001078309.1.74696 WP_001078309.1.74704 WP_001078309.1.74731 WP_001078309.1.74747 WP_001078309.1.74758 WP_001078309.1.74761 WP_001078309.1.74770 WP_001078309.1.74775 WP_001078309.1.74781 WP_001078309.1.74785 WP_001078309.1.74797 WP_001078309.1.74802 WP_001078309.1.74808 WP_001078309.1.7482 WP_001078309.1.74846 WP_001078309.1.74849 WP_001078309.1.74866 WP_001078309.1.74890 WP_001078309.1.74899 WP_001078309.1.74911 WP_001078309.1.74922 WP_001078309.1.74924 WP_001078309.1.74961 WP_001078309.1.74963 WP_001078309.1.74978 WP_001078309.1.74994 WP_001078309.1.74999 WP_001078309.1.7500 WP_001078309.1.75006 WP_001078309.1.75038 WP_001078309.1.75044 WP_001078309.1.75048 WP_001078309.1.75052 WP_001078309.1.75070 WP_001078309.1.75091 WP_001078309.1.75093 WP_001078309.1.75111 WP_001078309.1.75122 WP_001078309.1.75127 WP_001078309.1.75131 WP_001078309.1.75132 WP_001078309.1.75141 WP_001078309.1.75186 WP_001078309.1.75227 WP_001078309.1.75252 WP_001078309.1.75253 WP_001078309.1.75294 WP_001078309.1.75298 WP_001078309.1.75304 WP_001078309.1.75320 WP_001078309.1.75323 WP_001078309.1.75327 WP_001078309.1.75349 WP_001078309.1.75351 WP_001078309.1.75356 WP_001078309.1.75365 WP_001078309.1.75369 WP_001078309.1.75375 WP_001078309.1.75379 WP_001078309.1.75399 WP_001078309.1.75409 WP_001078309.1.75411 WP_001078309.1.7542 WP_001078309.1.75438 WP_001078309.1.75440 WP_001078309.1.75481 WP_001078309.1.75506 WP_001078309.1.75509 WP_001078309.1.75527 WP_001078309.1.75538 WP_001078309.1.75542 WP_001078309.1.75551 WP_001078309.1.75566 WP_001078309.1.75571 WP_001078309.1.7561 WP_001078309.1.75623 WP_001078309.1.75647 WP_001078309.1.75649 WP_001078309.1.75652 WP_001078309.1.75680 WP_001078309.1.75685 WP_001078309.1.75692 WP_001078309.1.75728 WP_001078309.1.75743 WP_001078309.1.75769 WP_001078309.1.75770 WP_001078309.1.75775 WP_001078309.1.758 WP_001078309.1.75800 WP_001078309.1.75809 WP_001078309.1.75824 WP_001078309.1.75830 WP_001078309.1.7584 WP_001078309.1.75840 WP_001078309.1.75848 WP_001078309.1.75851 WP_001078309.1.75856 WP_001078309.1.75862 WP_001078309.1.75879 WP_001078309.1.75881 WP_001078309.1.75885 WP_001078309.1.75910 WP_001078309.1.75929 WP_001078309.1.75952 WP_001078309.1.75956 WP_001078309.1.7596 WP_001078309.1.75969 WP_001078309.1.76010 WP_001078309.1.76013 WP_001078309.1.76015 WP_001078309.1.7602 WP_001078309.1.76047 WP_001078309.1.76049 WP_001078309.1.76050 WP_001078309.1.76053 WP_001078309.1.7607 WP_001078309.1.76071 WP_001078309.1.76073 WP_001078309.1.76111 WP_001078309.1.76112 WP_001078309.1.76114 WP_001078309.1.76121 WP_001078309.1.76136 WP_001078309.1.76143 WP_001078309.1.76149 WP_001078309.1.76153 WP_001078309.1.76179 WP_001078309.1.76185 WP_001078309.1.76230 WP_001078309.1.76234 WP_001078309.1.7624 WP_001078309.1.7625 WP_001078309.1.76258 WP_001078309.1.76261 WP_001078309.1.7627 WP_001078309.1.76282 WP_001078309.1.76283 WP_001078309.1.76294 WP_001078309.1.76295 WP_001078309.1.76313 WP_001078309.1.76323 WP_001078309.1.76332 WP_001078309.1.76333 WP_001078309.1.76337 WP_001078309.1.76351 WP_001078309.1.7638 WP_001078309.1.76411 WP_001078309.1.76419 WP_001078309.1.76420 WP_001078309.1.76421 WP_001078309.1.76424 WP_001078309.1.76426 WP_001078309.1.76431 WP_001078309.1.76463 WP_001078309.1.76482 WP_001078309.1.76497 WP_001078309.1.765 WP_001078309.1.76528 WP_001078309.1.7658 WP_001078309.1.76604 WP_001078309.1.76606 WP_001078309.1.76624 WP_001078309.1.76648 WP_001078309.1.76674 WP_001078309.1.76686 WP_001078309.1.76690 WP_001078309.1.76693 WP_001078309.1.76711 WP_001078309.1.76718 WP_001078309.1.7675 WP_001078309.1.76790 WP_001078309.1.76798 WP_001078309.1.768 WP_001078309.1.76803 WP_001078309.1.76816 WP_001078309.1.76825 WP_001078309.1.76829 WP_001078309.1.76839 WP_001078309.1.76845 WP_001078309.1.7686 WP_001078309.1.76867 WP_001078309.1.76872 WP_001078309.1.76876 WP_001078309.1.76878 WP_001078309.1.76897 WP_001078309.1.76920 WP_001078309.1.76921 WP_001078309.1.76937 WP_001078309.1.7694 WP_001078309.1.76952 WP_001078309.1.76998 WP_001078309.1.77013 WP_001078309.1.77020 WP_001078309.1.77027 WP_001078309.1.77031 WP_001078309.1.77041 WP_001078309.1.77043 WP_001078309.1.77050 WP_001078309.1.77060 WP_001078309.1.77062 WP_001078309.1.77069 WP_001078309.1.77072 WP_001078309.1.77112 WP_001078309.1.77137 WP_001078309.1.77145 WP_001078309.1.77158 WP_001078309.1.77176 WP_001078309.1.77183 WP_001078309.1.77187 WP_001078309.1.77190 WP_001078309.1.77203 WP_001078309.1.77229 WP_001078309.1.77256 WP_001078309.1.77259 WP_001078309.1.77297 WP_001078309.1.77298 WP_001078309.1.77305 WP_001078309.1.77315 WP_001078309.1.77331 WP_001078309.1.77346 WP_001078309.1.77354 WP_001078309.1.77359 WP_001078309.1.77388 WP_001078309.1.77416 WP_001078309.1.77426 WP_001078309.1.77446 WP_001078309.1.7745 WP_001078309.1.7746 WP_001078309.1.77485 WP_001078309.1.77489 WP_001078309.1.77497 WP_001078309.1.77498 WP_001078309.1.7752 WP_001078309.1.77520 WP_001078309.1.77527 WP_001078309.1.77532 WP_001078309.1.77533 WP_001078309.1.77536 WP_001078309.1.77572 WP_001078309.1.77603 WP_001078309.1.77606 WP_001078309.1.77650 WP_001078309.1.77674 WP_001078309.1.77733 WP_001078309.1.77735 WP_001078309.1.77738 WP_001078309.1.7774 WP_001078309.1.77743 WP_001078309.1.77745 WP_001078309.1.77763 WP_001078309.1.77791 WP_001078309.1.77805 WP_001078309.1.77814 WP_001078309.1.77818 WP_001078309.1.77822 WP_001078309.1.77827 WP_001078309.1.77832 WP_001078309.1.77848 WP_001078309.1.7785 WP_001078309.1.77858 WP_001078309.1.7786 WP_001078309.1.7787 WP_001078309.1.77882 WP_001078309.1.77893 WP_001078309.1.77896 WP_001078309.1.77908 WP_001078309.1.77915 WP_001078309.1.77922 WP_001078309.1.77930 WP_001078309.1.77952 WP_001078309.1.77957 WP_001078309.1.77986 WP_001078309.1.78002 WP_001078309.1.78038 WP_001078309.1.78050 WP_001078309.1.78054 WP_001078309.1.78067 WP_001078309.1.78082 WP_001078309.1.78091 WP_001078309.1.78093 WP_001078309.1.78095 WP_001078309.1.7810 WP_001078309.1.78116 WP_001078309.1.78126 WP_001078309.1.78164 WP_001078309.1.78173 WP_001078309.1.78179 WP_001078309.1.78185 WP_001078309.1.78189 WP_001078309.1.78194 WP_001078309.1.78207 WP_001078309.1.78208 WP_001078309.1.78210 WP_001078309.1.78252 WP_001078309.1.78254 WP_001078309.1.78257 WP_001078309.1.7827 WP_001078309.1.78304 WP_001078309.1.78311 WP_001078309.1.7833 WP_001078309.1.78330 WP_001078309.1.78332 WP_001078309.1.78335 WP_001078309.1.78365 WP_001078309.1.78371 WP_001078309.1.78392 WP_001078309.1.78404 WP_001078309.1.78434 WP_001078309.1.78436 WP_001078309.1.78458 WP_001078309.1.78470 WP_001078309.1.78478 WP_001078309.1.78489 WP_001078309.1.78494 WP_001078309.1.7850 WP_001078309.1.78513 WP_001078309.1.7853 WP_001078309.1.78550 WP_001078309.1.78558 WP_001078309.1.7857 WP_001078309.1.78573 WP_001078309.1.78582 WP_001078309.1.78585 WP_001078309.1.78592 WP_001078309.1.78596 WP_001078309.1.78598 WP_001078309.1.78604 WP_001078309.1.78625 WP_001078309.1.78633 WP_001078309.1.78653 WP_001078309.1.78662 WP_001078309.1.78667 WP_001078309.1.7868 WP_001078309.1.78685 WP_001078309.1.78708 WP_001078309.1.78728 WP_001078309.1.78731 WP_001078309.1.78736 WP_001078309.1.78758 WP_001078309.1.78763 WP_001078309.1.78785 WP_001078309.1.78803 WP_001078309.1.78816 WP_001078309.1.78819 WP_001078309.1.78841 WP_001078309.1.78872 WP_001078309.1.7888 WP_001078309.1.78897 WP_001078309.1.78920 WP_001078309.1.78934 WP_001078309.1.78937 WP_001078309.1.78946 WP_001078309.1.78983 WP_001078309.1.78985 WP_001078309.1.78991 WP_001078309.1.78995 WP_001078309.1.7900 WP_001078309.1.79006 WP_001078309.1.79037 WP_001078309.1.79038 WP_001078309.1.7905 WP_001078309.1.79051 WP_001078309.1.79085 WP_001078309.1.79110 WP_001078309.1.79114 WP_001078309.1.79131 WP_001078309.1.79132 WP_001078309.1.7914 WP_001078309.1.79143 WP_001078309.1.79170 WP_001078309.1.79178 WP_001078309.1.79192 WP_001078309.1.79197 WP_001078309.1.79208 WP_001078309.1.79223 WP_001078309.1.79227 WP_001078309.1.79244 WP_001078309.1.79270 WP_001078309.1.79275 WP_001078309.1.79285 WP_001078309.1.7930 WP_001078309.1.7931 WP_001078309.1.79310 WP_001078309.1.79314 WP_001078309.1.79320 WP_001078309.1.79322 WP_001078309.1.79332 WP_001078309.1.79334 WP_001078309.1.7934 WP_001078309.1.79341 WP_001078309.1.79367 WP_001078309.1.79374 WP_001078309.1.79378 WP_001078309.1.79379 WP_001078309.1.79402 WP_001078309.1.79407 WP_001078309.1.79408 WP_001078309.1.79436 WP_001078309.1.79461 WP_001078309.1.79473 WP_001078309.1.79476 WP_001078309.1.79487 WP_001078309.1.79539 WP_001078309.1.79543 WP_001078309.1.79552 WP_001078309.1.79554 WP_001078309.1.79556 WP_001078309.1.79566 WP_001078309.1.79581 WP_001078309.1.79626 WP_001078309.1.79627 WP_001078309.1.79638 WP_001078309.1.79646 WP_001078309.1.79662 WP_001078309.1.79672 WP_001078309.1.79676 WP_001078309.1.79677 WP_001078309.1.79706 WP_001078309.1.79731 WP_001078309.1.79763 WP_001078309.1.7981 WP_001078309.1.79810 WP_001078309.1.79815 WP_001078309.1.79822 WP_001078309.1.79831 WP_001078309.1.79834 WP_001078309.1.79837 WP_001078309.1.79855 WP_001078309.1.7989 WP_001078309.1.79896 WP_001078309.1.79904 WP_001078309.1.79911 WP_001078309.1.79919 WP_001078309.1.7992 WP_001078309.1.79941 WP_001078309.1.79949 WP_001078309.1.79961 WP_001078309.1.79971 WP_001078309.1.79991 WP_001078309.1.80000 WP_001078309.1.80009 WP_001078309.1.80013 WP_001078309.1.80029 WP_001078309.1.80032 WP_001078309.1.80034 WP_001078309.1.80042 WP_001078309.1.80079 WP_001078309.1.80086 WP_001078309.1.80109 WP_001078309.1.80119 WP_001078309.1.80120 WP_001078309.1.80122 WP_001078309.1.80124 WP_001078309.1.80127 WP_001078309.1.80146 WP_001078309.1.80147 WP_001078309.1.80159 WP_001078309.1.80178 WP_001078309.1.80184 WP_001078309.1.80193 WP_001078309.1.80203 WP_001078309.1.80206 WP_001078309.1.80210 WP_001078309.1.80244 WP_001078309.1.80274 WP_001078309.1.80287 WP_001078309.1.80290 WP_001078309.1.80297 WP_001078309.1.80303 WP_001078309.1.80308 WP_001078309.1.8031 WP_001078309.1.80316 WP_001078309.1.80318 WP_001078309.1.80345 WP_001078309.1.8035 WP_001078309.1.80358 WP_001078309.1.80361 WP_001078309.1.80389 WP_001078309.1.8040 WP_001078309.1.80407 WP_001078309.1.80414 WP_001078309.1.8043 WP_001078309.1.80430 WP_001078309.1.80434 WP_001078309.1.8045 WP_001078309.1.80472 WP_001078309.1.80482 WP_001078309.1.80521 WP_001078309.1.80530 WP_001078309.1.80582 WP_001078309.1.8065 WP_001078309.1.80653 WP_001078309.1.8066 WP_001078309.1.80680 WP_001078309.1.80687 WP_001078309.1.80717 WP_001078309.1.80734 WP_001078309.1.80745 WP_001078309.1.80761 WP_001078309.1.80763 WP_001078309.1.80781 WP_001078309.1.80786 WP_001078309.1.80793 WP_001078309.1.80801 WP_001078309.1.80828 WP_001078309.1.80833 WP_001078309.1.8084 WP_001078309.1.8085 WP_001078309.1.80855 WP_001078309.1.80872 WP_001078309.1.80899 WP_001078309.1.809 WP_001078309.1.80962 WP_001078309.1.80979 WP_001078309.1.80980 WP_001078309.1.81010 WP_001078309.1.81022 WP_001078309.1.81049 WP_001078309.1.81052 WP_001078309.1.81055 WP_001078309.1.81064 WP_001078309.1.81065 WP_001078309.1.81085 WP_001078309.1.81092 WP_001078309.1.81095 WP_001078309.1.81114 WP_001078309.1.81151 WP_001078309.1.81157 WP_001078309.1.81171 WP_001078309.1.81172 WP_001078309.1.81176 WP_001078309.1.81184 WP_001078309.1.81214 WP_001078309.1.81228 WP_001078309.1.81232 WP_001078309.1.81234 WP_001078309.1.81252 WP_001078309.1.81288 WP_001078309.1.81290 WP_001078309.1.81344 WP_001078309.1.8135 WP_001078309.1.81379 WP_001078309.1.81384 WP_001078309.1.81385 WP_001078309.1.81389 WP_001078309.1.8142 WP_001078309.1.81436 WP_001078309.1.8144 WP_001078309.1.81464 WP_001078309.1.81467 WP_001078309.1.81508 WP_001078309.1.81522 WP_001078309.1.81549 WP_001078309.1.81572 WP_001078309.1.81574 WP_001078309.1.81599 WP_001078309.1.8160 WP_001078309.1.81604 WP_001078309.1.81610 WP_001078309.1.81619 WP_001078309.1.81631 WP_001078309.1.81637 WP_001078309.1.81645 WP_001078309.1.81651 WP_001078309.1.81718 WP_001078309.1.81734 WP_001078309.1.81740 WP_001078309.1.81758 WP_001078309.1.8176 WP_001078309.1.8180 WP_001078309.1.81800 WP_001078309.1.81810 WP_001078309.1.81812 WP_001078309.1.81831 WP_001078309.1.81837 WP_001078309.1.81838 WP_001078309.1.81847 WP_001078309.1.8185 WP_001078309.1.81861 WP_001078309.1.81870 WP_001078309.1.8188 WP_001078309.1.81897 WP_001078309.1.81903 WP_001078309.1.81904 WP_001078309.1.81905 WP_001078309.1.81906 WP_001078309.1.81919 WP_001078309.1.81940 WP_001078309.1.81944 WP_001078309.1.81955 WP_001078309.1.81969 WP_001078309.1.81990 WP_001078309.1.81996 WP_001078309.1.81999 WP_001078309.1.82009 WP_001078309.1.82015 WP_001078309.1.82026 WP_001078309.1.82053 WP_001078309.1.82058 WP_001078309.1.8206 WP_001078309.1.82100 WP_001078309.1.82103 WP_001078309.1.8212 WP_001078309.1.82121 WP_001078309.1.8213 WP_001078309.1.82161 WP_001078309.1.82167 WP_001078309.1.82174 WP_001078309.1.82184 WP_001078309.1.82219 WP_001078309.1.82247 WP_001078309.1.82253 WP_001078309.1.82259 WP_001078309.1.82278 WP_001078309.1.82281 WP_001078309.1.82301 WP_001078309.1.82321 WP_001078309.1.82340 WP_001078309.1.82349 WP_001078309.1.82354 WP_001078309.1.82358 WP_001078309.1.82368 WP_001078309.1.82406 WP_001078309.1.8244 WP_001078309.1.82441 WP_001078309.1.82447 WP_001078309.1.82458 WP_001078309.1.8246 WP_001078309.1.82467 WP_001078309.1.82468 WP_001078309.1.82472 WP_001078309.1.82525 WP_001078309.1.82535 WP_001078309.1.82548 WP_001078309.1.82558 WP_001078309.1.82612 WP_001078309.1.8265 WP_001078309.1.8266 WP_001078309.1.82665 WP_001078309.1.82678 WP_001078309.1.82709 WP_001078309.1.82724 WP_001078309.1.82760 WP_001078309.1.82762 WP_001078309.1.82768 WP_001078309.1.82775 WP_001078309.1.82796 WP_001078309.1.8280 WP_001078309.1.82802 WP_001078309.1.82824 WP_001078309.1.82829 WP_001078309.1.82835 WP_001078309.1.82855 WP_001078309.1.82862 WP_001078309.1.8289 WP_001078309.1.82916 WP_001078309.1.82930 WP_001078309.1.82931 WP_001078309.1.82941 WP_001078309.1.82976 WP_001078309.1.82980 WP_001078309.1.82984 WP_001078309.1.82997 WP_001078309.1.82999 WP_001078309.1.83011 WP_001078309.1.83013 WP_001078309.1.83046 WP_001078309.1.83050 WP_001078309.1.83053 WP_001078309.1.83054 WP_001078309.1.83066 WP_001078309.1.83078 WP_001078309.1.83086 WP_001078309.1.83088 WP_001078309.1.8310 WP_001078309.1.83103 WP_001078309.1.83152 WP_001078309.1.83153 WP_001078309.1.8318 WP_001078309.1.83185 WP_001078309.1.83193 WP_001078309.1.83203 WP_001078309.1.83234 WP_001078309.1.83243 WP_001078309.1.83249 WP_001078309.1.8328 WP_001078309.1.83291 WP_001078309.1.83314 WP_001078309.1.83316 WP_001078309.1.83352 WP_001078309.1.83359 WP_001078309.1.83372 WP_001078309.1.83405 WP_001078309.1.83416 WP_001078309.1.83417 WP_001078309.1.83418 WP_001078309.1.8346 WP_001078309.1.83467 WP_001078309.1.83468 WP_001078309.1.83472 WP_001078309.1.83475 WP_001078309.1.83476 WP_001078309.1.83479 WP_001078309.1.83484 WP_001078309.1.83517 WP_001078309.1.83520 WP_001078309.1.83541 WP_001078309.1.83553 WP_001078309.1.83592 WP_001078309.1.83624 WP_001078309.1.83626 WP_001078309.1.83645 WP_001078309.1.83646 WP_001078309.1.83653 WP_001078309.1.8366 WP_001078309.1.83674 WP_001078309.1.83676 WP_001078309.1.83714 WP_001078309.1.83720 WP_001078309.1.83728 WP_001078309.1.83750 WP_001078309.1.83756 WP_001078309.1.83758 WP_001078309.1.83763 WP_001078309.1.83769 WP_001078309.1.83770 WP_001078309.1.83775 WP_001078309.1.83778 WP_001078309.1.83788 WP_001078309.1.83797 WP_001078309.1.83804 WP_001078309.1.83825 WP_001078309.1.8383 WP_001078309.1.83837 WP_001078309.1.83844 WP_001078309.1.8385 WP_001078309.1.83852 WP_001078309.1.83864 WP_001078309.1.83865 WP_001078309.1.83868 WP_001078309.1.83881 WP_001078309.1.83886 WP_001078309.1.83902 WP_001078309.1.83905 WP_001078309.1.83912 WP_001078309.1.83917 WP_001078309.1.83919 WP_001078309.1.83925 WP_001078309.1.83928 WP_001078309.1.83935 WP_001078309.1.83955 WP_001078309.1.83980 WP_001078309.1.83984 WP_001078309.1.83989 WP_001078309.1.84010 WP_001078309.1.84025 WP_001078309.1.84041 WP_001078309.1.84049 WP_001078309.1.84054 WP_001078309.1.84064 WP_001078309.1.84067 WP_001078309.1.84068 WP_001078309.1.84118 WP_001078309.1.84129 WP_001078309.1.84144 WP_001078309.1.84161 WP_001078309.1.84163 WP_001078309.1.84188 WP_001078309.1.84275 WP_001078309.1.84284 WP_001078309.1.84293 WP_001078309.1.84322 WP_001078309.1.84342 WP_001078309.1.84414 WP_001078309.1.84415 WP_001078309.1.84416 WP_001078309.1.84418 WP_001078309.1.84442 WP_001078309.1.84445 WP_001078309.1.84451 WP_001078309.1.84508 WP_001078309.1.84509 WP_001078309.1.84555 WP_001078309.1.84563 WP_001078309.1.84570 WP_001078309.1.84578 WP_001078309.1.84590 WP_001078309.1.84596 WP_001078309.1.84602 WP_001078309.1.84608 WP_001078309.1.84612 WP_001078309.1.8462 WP_001078309.1.84625 WP_001078309.1.84630 WP_001078309.1.84638 WP_001078309.1.84648 WP_001078309.1.84651 WP_001078309.1.84652 WP_001078309.1.84662 WP_001078309.1.8468 WP_001078309.1.84682 WP_001078309.1.84696 WP_001078309.1.84700 WP_001078309.1.8475 WP_001078309.1.84752 WP_001078309.1.84757 WP_001078309.1.84761 WP_001078309.1.84770 WP_001078309.1.84815 WP_001078309.1.84826 WP_001078309.1.84844 WP_001078309.1.84847 WP_001078309.1.84854 WP_001078309.1.84889 WP_001078309.1.84903 WP_001078309.1.84907 WP_001078309.1.84922 WP_001078309.1.84924 WP_001078309.1.8493 WP_001078309.1.84943 WP_001078309.1.8496 WP_001078309.1.84975 WP_001078309.1.84978 WP_001078309.1.85017 WP_001078309.1.85022 WP_001078309.1.85026 WP_001078309.1.85045 WP_001078309.1.85047 WP_001078309.1.85056 WP_001078309.1.85070 WP_001078309.1.85081 WP_001078309.1.85083 WP_001078309.1.85099 WP_001078309.1.851 WP_001078309.1.85113 WP_001078309.1.85118 WP_001078309.1.85132 WP_001078309.1.85135 WP_001078309.1.85144 WP_001078309.1.85151 WP_001078309.1.85160 WP_001078309.1.85173 WP_001078309.1.85213 WP_001078309.1.85224 WP_001078309.1.85226 WP_001078309.1.85229 WP_001078309.1.85235 WP_001078309.1.85238 WP_001078309.1.85289 WP_001078309.1.85292 WP_001078309.1.85294 WP_001078309.1.85297 WP_001078309.1.85302 WP_001078309.1.85351 WP_001078309.1.85374 WP_001078309.1.85375 WP_001078309.1.85376 WP_001078309.1.85383 WP_001078309.1.85395 WP_001078309.1.85404 WP_001078309.1.85409 WP_001078309.1.85440 WP_001078309.1.85441 WP_001078309.1.85445 WP_001078309.1.85455 WP_001078309.1.85462 WP_001078309.1.85471 WP_001078309.1.85474 WP_001078309.1.85485 WP_001078309.1.85492 WP_001078309.1.85506 WP_001078309.1.8551 WP_001078309.1.85515 WP_001078309.1.85519 WP_001078309.1.85542 WP_001078309.1.85585 WP_001078309.1.85586 WP_001078309.1.85596 WP_001078309.1.85607 WP_001078309.1.85611 WP_001078309.1.85649 WP_001078309.1.85678 WP_001078309.1.85705 WP_001078309.1.8572 WP_001078309.1.85730 WP_001078309.1.85732 WP_001078309.1.85758 WP_001078309.1.8576 WP_001078309.1.85795 WP_001078309.1.85796 WP_001078309.1.85809 WP_001078309.1.85816 WP_001078309.1.85825 WP_001078309.1.85834 WP_001078309.1.85844 WP_001078309.1.85858 WP_001078309.1.85873 WP_001078309.1.85906 WP_001078309.1.85924 WP_001078309.1.85927 WP_001078309.1.85950 WP_001078309.1.85971 WP_001078309.1.85980 WP_001078309.1.85989 WP_001078309.1.85993 WP_001078309.1.86018 WP_001078309.1.86036 WP_001078309.1.86042 WP_001078309.1.86072 WP_001078309.1.86086 WP_001078309.1.8609 WP_001078309.1.86101 WP_001078309.1.86106 WP_001078309.1.86123 WP_001078309.1.86144 WP_001078309.1.86154 WP_001078309.1.86158 WP_001078309.1.8617 WP_001078309.1.86178 WP_001078309.1.86188 WP_001078309.1.862 WP_001078309.1.86207 WP_001078309.1.86209 WP_001078309.1.86241 WP_001078309.1.86248 WP_001078309.1.86256 WP_001078309.1.8627 WP_001078309.1.86270 WP_001078309.1.86281 WP_001078309.1.86304 WP_001078309.1.86315 WP_001078309.1.86344 WP_001078309.1.8636 WP_001078309.1.86363 WP_001078309.1.86367 WP_001078309.1.86378 WP_001078309.1.86390 WP_001078309.1.86439 WP_001078309.1.86473 WP_001078309.1.86482 WP_001078309.1.86505 WP_001078309.1.86508 WP_001078309.1.86523 WP_001078309.1.86526 WP_001078309.1.86531 WP_001078309.1.86542 WP_001078309.1.86606 WP_001078309.1.86628 WP_001078309.1.86629 WP_001078309.1.86664 WP_001078309.1.86704 WP_001078309.1.86706 WP_001078309.1.86736 WP_001078309.1.86745 WP_001078309.1.86754 WP_001078309.1.86779 WP_001078309.1.86792 WP_001078309.1.86793 WP_001078309.1.86795 WP_001078309.1.8681 WP_001078309.1.86838 WP_001078309.1.86881 WP_001078309.1.8690 WP_001078309.1.86910 WP_001078309.1.86911 WP_001078309.1.86940 WP_001078309.1.86942 WP_001078309.1.86955 WP_001078309.1.86961 WP_001078309.1.86968 WP_001078309.1.86977 WP_001078309.1.8699 WP_001078309.1.86999 WP_001078309.1.87021 WP_001078309.1.87022 WP_001078309.1.87042 WP_001078309.1.87057 WP_001078309.1.87072 WP_001078309.1.87088 WP_001078309.1.87090 WP_001078309.1.87096 WP_001078309.1.87097 WP_001078309.1.87100 WP_001078309.1.87110 WP_001078309.1.87119 WP_001078309.1.8712 WP_001078309.1.87122 WP_001078309.1.87133 WP_001078309.1.87137 WP_001078309.1.87141 WP_001078309.1.87168 WP_001078309.1.87175 WP_001078309.1.87190 WP_001078309.1.87194 WP_001078309.1.8720 WP_001078309.1.87204 WP_001078309.1.87221 WP_001078309.1.87250 WP_001078309.1.87260 WP_001078309.1.87261 WP_001078309.1.87263 WP_001078309.1.87264 WP_001078309.1.87272 WP_001078309.1.87285 WP_001078309.1.87290 WP_001078309.1.87296 WP_001078309.1.8731 WP_001078309.1.87363 WP_001078309.1.87372 WP_001078309.1.87378 WP_001078309.1.87388 WP_001078309.1.87391 WP_001078309.1.87396 WP_001078309.1.87397 WP_001078309.1.87425 WP_001078309.1.87434 WP_001078309.1.87457 WP_001078309.1.87461 WP_001078309.1.87466 WP_001078309.1.87475 WP_001078309.1.87486 WP_001078309.1.87497 WP_001078309.1.87498 WP_001078309.1.875 WP_001078309.1.87502 WP_001078309.1.87508 WP_001078309.1.87511 WP_001078309.1.87515 WP_001078309.1.8753 WP_001078309.1.87541 WP_001078309.1.87543 WP_001078309.1.8757 WP_001078309.1.87579 WP_001078309.1.87595 WP_001078309.1.87601 WP_001078309.1.87623 WP_001078309.1.8764 WP_001078309.1.87647 WP_001078309.1.87710 WP_001078309.1.87718 WP_001078309.1.87734 WP_001078309.1.87735 WP_001078309.1.87740 WP_001078309.1.87745 WP_001078309.1.87748 WP_001078309.1.87764 WP_001078309.1.87782 WP_001078309.1.8779 WP_001078309.1.87802 WP_001078309.1.87808 WP_001078309.1.87828 WP_001078309.1.87838 WP_001078309.1.87841 WP_001078309.1.87843 WP_001078309.1.87854 WP_001078309.1.87865 WP_001078309.1.87879 WP_001078309.1.8791 WP_001078309.1.87912 WP_001078309.1.87937 WP_001078309.1.87943 WP_001078309.1.87948 WP_001078309.1.87964 WP_001078309.1.87967 WP_001078309.1.87972 WP_001078309.1.87985 WP_001078309.1.87995 WP_001078309.1.88013 WP_001078309.1.88032 WP_001078309.1.88061 WP_001078309.1.88101 WP_001078309.1.88114 WP_001078309.1.88150 WP_001078309.1.88166 WP_001078309.1.88169 WP_001078309.1.8820 WP_001078309.1.88240 WP_001078309.1.88270 WP_001078309.1.88279 WP_001078309.1.88309 WP_001078309.1.88317 WP_001078309.1.88319 WP_001078309.1.88328 WP_001078309.1.88348 WP_001078309.1.88351 WP_001078309.1.88367 WP_001078309.1.88371 WP_001078309.1.88373 WP_001078309.1.88375 WP_001078309.1.88380 WP_001078309.1.88395 WP_001078309.1.88418 WP_001078309.1.88430 WP_001078309.1.88440 WP_001078309.1.88455 WP_001078309.1.8847 WP_001078309.1.88471 WP_001078309.1.88473 WP_001078309.1.88478 WP_001078309.1.88480 WP_001078309.1.88490 WP_001078309.1.88498 WP_001078309.1.88518 WP_001078309.1.88536 WP_001078309.1.88555 WP_001078309.1.88558 WP_001078309.1.88560 WP_001078309.1.88563 WP_001078309.1.8857 WP_001078309.1.88580 WP_001078309.1.88583 WP_001078309.1.88585 WP_001078309.1.8859 WP_001078309.1.88599 WP_001078309.1.88600 WP_001078309.1.88614 WP_001078309.1.88623 WP_001078309.1.88636 WP_001078309.1.88642 WP_001078309.1.88671 WP_001078309.1.88694 WP_001078309.1.88696 WP_001078309.1.8872 WP_001078309.1.88738 WP_001078309.1.88739 WP_001078309.1.88753 WP_001078309.1.88761 WP_001078309.1.88771 WP_001078309.1.88781 WP_001078309.1.88805 WP_001078309.1.88827 WP_001078309.1.88843 WP_001078309.1.88856 WP_001078309.1.88859 WP_001078309.1.8886 WP_001078309.1.88861 WP_001078309.1.88871 WP_001078309.1.88874 WP_001078309.1.88878 WP_001078309.1.8888 WP_001078309.1.88897 WP_001078309.1.88912 WP_001078309.1.88922 WP_001078309.1.88934 WP_001078309.1.88954 WP_001078309.1.88959 WP_001078309.1.88960 WP_001078309.1.88962 WP_001078309.1.88987 WP_001078309.1.8899 WP_001078309.1.8900 WP_001078309.1.89012 WP_001078309.1.89024 WP_001078309.1.89036 WP_001078309.1.8904 WP_001078309.1.89070 WP_001078309.1.89086 WP_001078309.1.89103 WP_001078309.1.89125 WP_001078309.1.8913 WP_001078309.1.89133 WP_001078309.1.89164 WP_001078309.1.89173 WP_001078309.1.8918 WP_001078309.1.89181 WP_001078309.1.89194 WP_001078309.1.89195 WP_001078309.1.89204 WP_001078309.1.89229 WP_001078309.1.89235 WP_001078309.1.89237 WP_001078309.1.8924 WP_001078309.1.89258 WP_001078309.1.89262 WP_001078309.1.89284 WP_001078309.1.8929 WP_001078309.1.89290 WP_001078309.1.89347 WP_001078309.1.89348 WP_001078309.1.89350 WP_001078309.1.89390 WP_001078309.1.89404 WP_001078309.1.89414 WP_001078309.1.89433 WP_001078309.1.89439 WP_001078309.1.89516 WP_001078309.1.8953 WP_001078309.1.89537 WP_001078309.1.89544 WP_001078309.1.89545 WP_001078309.1.89559 WP_001078309.1.89594 WP_001078309.1.89628 WP_001078309.1.89651 WP_001078309.1.89655 WP_001078309.1.89672 WP_001078309.1.89678 WP_001078309.1.897 WP_001078309.1.89715 WP_001078309.1.89726 WP_001078309.1.89730 WP_001078309.1.89738 WP_001078309.1.89754 WP_001078309.1.89779 WP_001078309.1.89794 WP_001078309.1.898 WP_001078309.1.89857 WP_001078309.1.89860 WP_001078309.1.89863 WP_001078309.1.89874 WP_001078309.1.89883 WP_001078309.1.8990 WP_001078309.1.89908 WP_001078309.1.89933 WP_001078309.1.89935 WP_001078309.1.89949 WP_001078309.1.89950 WP_001078309.1.89960 WP_001078309.1.90005 WP_001078309.1.90018 WP_001078309.1.90038 WP_001078309.1.90046 WP_001078309.1.90055 WP_001078309.1.90069 WP_001078309.1.90091 WP_001078309.1.90112 WP_001078309.1.90131 WP_001078309.1.90148 WP_001078309.1.90161 WP_001078309.1.90173 WP_001078309.1.90174 WP_001078309.1.90180 WP_001078309.1.90215 WP_001078309.1.90217 WP_001078309.1.9022 WP_001078309.1.90232 WP_001078309.1.90239 WP_001078309.1.90243 WP_001078309.1.90244 WP_001078309.1.90246 WP_001078309.1.90250 WP_001078309.1.90253 WP_001078309.1.90269 WP_001078309.1.90276 WP_001078309.1.9030 WP_001078309.1.90307 WP_001078309.1.90331 WP_001078309.1.90367 WP_001078309.1.90386 WP_001078309.1.90432 WP_001078309.1.90447 WP_001078309.1.90454 WP_001078309.1.90473 WP_001078309.1.90475 WP_001078309.1.90488 WP_001078309.1.90506 WP_001078309.1.90514 WP_001078309.1.90517 WP_001078309.1.90533 WP_001078309.1.90544 WP_001078309.1.90548 WP_001078309.1.9055 WP_001078309.1.90554 WP_001078309.1.90556 WP_001078309.1.90562 WP_001078309.1.90604 WP_001078309.1.90647 WP_001078309.1.90660 WP_001078309.1.90661 WP_001078309.1.90683 WP_001078309.1.90698 WP_001078309.1.9071 WP_001078309.1.90717 WP_001078309.1.90726 WP_001078309.1.90728 WP_001078309.1.90738 WP_001078309.1.9074 WP_001078309.1.90745 WP_001078309.1.9076 WP_001078309.1.90777 WP_001078309.1.90801 WP_001078309.1.90804 WP_001078309.1.90818 WP_001078309.1.90861 WP_001078309.1.90875 WP_001078309.1.90887 WP_001078309.1.90896 WP_001078309.1.90903 WP_001078309.1.90923 WP_001078309.1.90928 WP_001078309.1.90994 WP_001078309.1.9100 WP_001078309.1.91005 WP_001078309.1.91011 WP_001078309.1.91019 WP_001078309.1.91054 WP_001078309.1.91087 WP_001078309.1.91089 WP_001078309.1.91124 WP_001078309.1.91126 WP_001078309.1.9114 WP_001078309.1.91150 WP_001078309.1.91158 WP_001078309.1.91177 WP_001078309.1.91184 WP_001078309.1.912 WP_001078309.1.9122 WP_001078309.1.91233 WP_001078309.1.91246 WP_001078309.1.91252 WP_001078309.1.91258 WP_001078309.1.9127 WP_001078309.1.91279 WP_001078309.1.91280 WP_001078309.1.91287 WP_001078309.1.9130 WP_001078309.1.91300 WP_001078309.1.91310 WP_001078309.1.91316 WP_001078309.1.91332 WP_001078309.1.91346 WP_001078309.1.91357 WP_001078309.1.91364 WP_001078309.1.91365 WP_001078309.1.91371 WP_001078309.1.91380 WP_001078309.1.91382 WP_001078309.1.9140 WP_001078309.1.91420 WP_001078309.1.91427 WP_001078309.1.91447 WP_001078309.1.91465 WP_001078309.1.91486 WP_001078309.1.91487 WP_001078309.1.91500 WP_001078309.1.91501 WP_001078309.1.91525 WP_001078309.1.91530 WP_001078309.1.91542 WP_001078309.1.91547 WP_001078309.1.9155 WP_001078309.1.91559 WP_001078309.1.91573 WP_001078309.1.91581 WP_001078309.1.91586 WP_001078309.1.91587 WP_001078309.1.91591 WP_001078309.1.91611 WP_001078309.1.91629 WP_001078309.1.91634 WP_001078309.1.91635 WP_001078309.1.91639 WP_001078309.1.91670 WP_001078309.1.917 WP_001078309.1.91704 WP_001078309.1.91749 WP_001078309.1.91771 WP_001078309.1.91781 WP_001078309.1.91791 WP_001078309.1.91800 WP_001078309.1.91816 WP_001078309.1.91829 WP_001078309.1.91848 WP_001078309.1.91895 WP_001078309.1.91911 WP_001078309.1.91918 WP_001078309.1.91928 WP_001078309.1.91950 WP_001078309.1.91955 WP_001078309.1.91969 WP_001078309.1.92 WP_001078309.1.92057 WP_001078309.1.92104 WP_001078309.1.92110 WP_001078309.1.92125 WP_001078309.1.92133 WP_001078309.1.92140 WP_001078309.1.92143 WP_001078309.1.92158 WP_001078309.1.92164 WP_001078309.1.92169 WP_001078309.1.92173 WP_001078309.1.92185 WP_001078309.1.92186 WP_001078309.1.92196 WP_001078309.1.92212 WP_001078309.1.92218 WP_001078309.1.92227 WP_001078309.1.92228 WP_001078309.1.9224 WP_001078309.1.92244 WP_001078309.1.92249 WP_001078309.1.92253 WP_001078309.1.92254 WP_001078309.1.92259 WP_001078309.1.92278 WP_001078309.1.92297 WP_001078309.1.923 WP_001078309.1.92303 WP_001078309.1.92324 WP_001078309.1.9234 WP_001078309.1.92340 WP_001078309.1.9239 WP_001078309.1.92391 WP_001078309.1.92398 WP_001078309.1.92405 WP_001078309.1.92415 WP_001078309.1.92424 WP_001078309.1.92425 WP_001078309.1.92436 WP_001078309.1.92442 WP_001078309.1.9247 WP_001078309.1.92479 WP_001078309.1.92488 WP_001078309.1.92497 WP_001078309.1.92500 WP_001078309.1.92512 WP_001078309.1.92520 WP_001078309.1.92534 WP_001078309.1.92541 WP_001078309.1.92560 WP_001078309.1.92565 WP_001078309.1.92602 WP_001078309.1.92607 WP_001078309.1.92667 WP_001078309.1.92674 WP_001078309.1.92679 WP_001078309.1.92691 WP_001078309.1.92718 WP_001078309.1.92723 WP_001078309.1.92726 WP_001078309.1.92735 WP_001078309.1.92741 WP_001078309.1.92765 WP_001078309.1.92772 WP_001078309.1.92773 WP_001078309.1.92778 WP_001078309.1.92789 WP_001078309.1.92795 WP_001078309.1.92805 WP_001078309.1.92840 WP_001078309.1.92848 WP_001078309.1.92849 WP_001078309.1.9286 WP_001078309.1.92862 WP_001078309.1.92864 WP_001078309.1.92897 WP_001078309.1.92918 WP_001078309.1.9293 WP_001078309.1.92937 WP_001078309.1.92950 WP_001078309.1.9296 WP_001078309.1.92960 WP_001078309.1.92965 WP_001078309.1.9298 WP_001078309.1.92997 WP_001078309.1.93010 WP_001078309.1.93047 WP_001078309.1.9305 WP_001078309.1.93068 WP_001078309.1.93071 WP_001078309.1.93074 WP_001078309.1.93078 WP_001078309.1.93125 WP_001078309.1.93141 WP_001078309.1.93147 WP_001078309.1.93163 WP_001078309.1.93176 WP_001078309.1.93186 WP_001078309.1.93191 WP_001078309.1.93197 WP_001078309.1.93207 WP_001078309.1.93211 WP_001078309.1.93224 WP_001078309.1.93231 WP_001078309.1.93235 WP_001078309.1.93237 WP_001078309.1.93243 WP_001078309.1.93251 WP_001078309.1.93254 WP_001078309.1.93260 WP_001078309.1.93296 WP_001078309.1.93300 WP_001078309.1.93310 WP_001078309.1.93316 WP_001078309.1.93329 WP_001078309.1.93336 WP_001078309.1.93354 WP_001078309.1.93378 WP_001078309.1.93416 WP_001078309.1.93435 WP_001078309.1.93438 WP_001078309.1.93444 WP_001078309.1.9346 WP_001078309.1.93471 WP_001078309.1.93492 WP_001078309.1.93514 WP_001078309.1.9352 WP_001078309.1.9354 WP_001078309.1.93561 WP_001078309.1.93567 WP_001078309.1.93579 WP_001078309.1.9358 WP_001078309.1.93590 WP_001078309.1.93613 WP_001078309.1.93658 WP_001078309.1.93678 WP_001078309.1.93690 WP_001078309.1.93708 WP_001078309.1.93710 WP_001078309.1.93722 WP_001078309.1.93736 WP_001078309.1.93738 WP_001078309.1.93758 WP_001078309.1.93762 WP_001078309.1.93769 WP_001078309.1.93775 WP_001078309.1.93787 WP_001078309.1.93862 WP_001078309.1.9387 WP_001078309.1.93882 WP_001078309.1.93883 WP_001078309.1.93890 WP_001078309.1.93891 WP_001078309.1.9392 WP_001078309.1.93934 WP_001078309.1.93972 WP_001078309.1.93976 WP_001078309.1.9398 WP_001078309.1.93981 WP_001078309.1.94 WP_001078309.1.94009 WP_001078309.1.94016 WP_001078309.1.94053 WP_001078309.1.94060 WP_001078309.1.94074 WP_001078309.1.9408 WP_001078309.1.94080 WP_001078309.1.94082 WP_001078309.1.94087 WP_001078309.1.94096 WP_001078309.1.9411 WP_001078309.1.94114 WP_001078309.1.94119 WP_001078309.1.94122 WP_001078309.1.94123 WP_001078309.1.94130 WP_001078309.1.94165 WP_001078309.1.94172 WP_001078309.1.94209 WP_001078309.1.94242 WP_001078309.1.94245 WP_001078309.1.94248 WP_001078309.1.94268 WP_001078309.1.94287 WP_001078309.1.94293 WP_001078309.1.94294 WP_001078309.1.9430 WP_001078309.1.94319 WP_001078309.1.94320 WP_001078309.1.94324 WP_001078309.1.94325 WP_001078309.1.94335 WP_001078309.1.94337 WP_001078309.1.94340 WP_001078309.1.94341 WP_001078309.1.94345 WP_001078309.1.9435 WP_001078309.1.9437 WP_001078309.1.94374 WP_001078309.1.94375 WP_001078309.1.94376 WP_001078309.1.94389 WP_001078309.1.94409 WP_001078309.1.94414 WP_001078309.1.94423 WP_001078309.1.94484 WP_001078309.1.94505 WP_001078309.1.94530 WP_001078309.1.94536 WP_001078309.1.94549 WP_001078309.1.9455 WP_001078309.1.94550 WP_001078309.1.94576 WP_001078309.1.94636 WP_001078309.1.9464 WP_001078309.1.94641 WP_001078309.1.94684 WP_001078309.1.94688 WP_001078309.1.947 WP_001078309.1.94741 WP_001078309.1.94789 WP_001078309.1.94797 WP_001078309.1.94825 WP_001078309.1.94844 WP_001078309.1.94845 WP_001078309.1.9485 WP_001078309.1.94857 WP_001078309.1.94866 WP_001078309.1.94941 WP_001078309.1.9495 WP_001078309.1.94958 WP_001078309.1.94969 WP_001078309.1.9497 WP_001078309.1.94980 WP_001078309.1.94989 WP_001078309.1.94992 WP_001078309.1.94999 WP_001078309.1.95008 WP_001078309.1.95014 WP_001078309.1.95023 WP_001078309.1.95029 WP_001078309.1.95033 WP_001078309.1.95038 WP_001078309.1.95049 WP_001078309.1.95075 WP_001078309.1.95077 WP_001078309.1.95090 WP_001078309.1.9510 WP_001078309.1.95120 WP_001078309.1.95154 WP_001078309.1.95156 WP_001078309.1.95174 WP_001078309.1.95193 WP_001078309.1.95210 WP_001078309.1.95263 WP_001078309.1.95281 WP_001078309.1.95294 WP_001078309.1.95304 WP_001078309.1.95307 WP_001078309.1.95318 WP_001078309.1.95342 WP_001078309.1.95361 WP_001078309.1.95372 WP_001078309.1.9538 WP_001078309.1.95386 WP_001078309.1.95409 WP_001078309.1.95415 WP_001078309.1.9544 WP_001078309.1.95452 WP_001078309.1.95476 WP_001078309.1.95494 WP_001078309.1.95495 WP_001078309.1.95500 WP_001078309.1.95505 WP_001078309.1.95512 WP_001078309.1.95519 WP_001078309.1.95522 WP_001078309.1.95537 WP_001078309.1.95545 WP_001078309.1.95550 WP_001078309.1.95560 WP_001078309.1.9557 WP_001078309.1.95571 WP_001078309.1.95581 WP_001078309.1.9563 WP_001078309.1.95639 WP_001078309.1.95681 WP_001078309.1.95683 WP_001078309.1.95699 WP_001078309.1.95704 WP_001078309.1.95713 WP_001078309.1.95714 WP_001078309.1.95737 WP_001078309.1.95760 WP_001078309.1.95780 WP_001078309.1.95781 WP_001078309.1.95804 WP_001078309.1.95806 WP_001078309.1.95832 WP_001078309.1.95877 WP_001078309.1.95885 WP_001078309.1.959 WP_001078309.1.95914 WP_001078309.1.95918 WP_001078309.1.95947 WP_001078309.1.95954 WP_001078309.1.95962 WP_001078309.1.95983 WP_001078309.1.95986 WP_001078309.1.95997 WP_001078309.1.96014 WP_001078309.1.96022 WP_001078309.1.96030 WP_001078309.1.96057 WP_001078309.1.96067 WP_001078309.1.96075 WP_001078309.1.96133 WP_001078309.1.96135 WP_001078309.1.96148 WP_001078309.1.96160 WP_001078309.1.96163 WP_001078309.1.96165 WP_001078309.1.9617 WP_001078309.1.96200 WP_001078309.1.96209 WP_001078309.1.96218 WP_001078309.1.96221 WP_001078309.1.96228 WP_001078309.1.96255 WP_001078309.1.96261 WP_001078309.1.96271 WP_001078309.1.96280 WP_001078309.1.96283 WP_001078309.1.96297 WP_001078309.1.96301 WP_001078309.1.96305 WP_001078309.1.96312 WP_001078309.1.96314 WP_001078309.1.96316 WP_001078309.1.96322 WP_001078309.1.96362 WP_001078309.1.96368 WP_001078309.1.96412 WP_001078309.1.96433 WP_001078309.1.96468 WP_001078309.1.96472 WP_001078309.1.96474 WP_001078309.1.96495 WP_001078309.1.9650 WP_001078309.1.96509 WP_001078309.1.96535 WP_001078309.1.96538 WP_001078309.1.96548 WP_001078309.1.96550 WP_001078309.1.96554 WP_001078309.1.96566 WP_001078309.1.96568 WP_001078309.1.96577 WP_001078309.1.96591 WP_001078309.1.96603 WP_001078309.1.96613 WP_001078309.1.96628 WP_001078309.1.96634 WP_001078309.1.96646 WP_001078309.1.96654 WP_001078309.1.96663 WP_001078309.1.96678 WP_001078309.1.96688 WP_001078309.1.96699 WP_001078309.1.96705 WP_001078309.1.96727 WP_001078309.1.9675 WP_001078309.1.96770 WP_001078309.1.96780 WP_001078309.1.96804 WP_001078309.1.96836 WP_001078309.1.9684 WP_001078309.1.96854 WP_001078309.1.96855 WP_001078309.1.96856 WP_001078309.1.96859 WP_001078309.1.96866 WP_001078309.1.96882 WP_001078309.1.96892 WP_001078309.1.96895 WP_001078309.1.96918 WP_001078309.1.96922 WP_001078309.1.96928 WP_001078309.1.9695 WP_001078309.1.96965 WP_001078309.1.96969 WP_001078309.1.96970 WP_001078309.1.96976 WP_001078309.1.96985 WP_001078309.1.96997 WP_001078309.1.97000 WP_001078309.1.97001 WP_001078309.1.97004 WP_001078309.1.97007 WP_001078309.1.97014 WP_001078309.1.97017 WP_001078309.1.97019 WP_001078309.1.97029 WP_001078309.1.97034 WP_001078309.1.97072 WP_001078309.1.97077 WP_001078309.1.97117 WP_001078309.1.97138 WP_001078309.1.97139 WP_001078309.1.97141 WP_001078309.1.97151 WP_001078309.1.97161 WP_001078309.1.97164 WP_001078309.1.97191 WP_001078309.1.97205 WP_001078309.1.97206 WP_001078309.1.97228 WP_001078309.1.97230 WP_001078309.1.97234 WP_001078309.1.97241 WP_001078309.1.97256 WP_001078309.1.97267 WP_001078309.1.97276 WP_001078309.1.97293 WP_001078309.1.97295 WP_001078309.1.97311 WP_001078309.1.97312 WP_001078309.1.97336 WP_001078309.1.97348 WP_001078309.1.97352 WP_001078309.1.97355 WP_001078309.1.97367 WP_001078309.1.9737 WP_001078309.1.97392 WP_001078309.1.97399 WP_001078309.1.97411 WP_001078309.1.97427 WP_001078309.1.9743 WP_001078309.1.97444 WP_001078309.1.97450 WP_001078309.1.97456 WP_001078309.1.97466 WP_001078309.1.97468 WP_001078309.1.97494 WP_001078309.1.97530 WP_001078309.1.97531 WP_001078309.1.97536 WP_001078309.1.97537 WP_001078309.1.97574 WP_001078309.1.97576 WP_001078309.1.97585 WP_001078309.1.97627 WP_001078309.1.97664 WP_001078309.1.97687 WP_001078309.1.97688 WP_001078309.1.97696 WP_001078309.1.97699 WP_001078309.1.97706 WP_001078309.1.97720 WP_001078309.1.97729 WP_001078309.1.97731 WP_001078309.1.97739 WP_001078309.1.97746 WP_001078309.1.97758 WP_001078309.1.97762 WP_001078309.1.97763 WP_001078309.1.97776 WP_001078309.1.97786 WP_001078309.1.97827 WP_001078309.1.97835 WP_001078309.1.9788 WP_001078309.1.9789 WP_001078309.1.97898 WP_001078309.1.97899 WP_001078309.1.97928 WP_001078309.1.97935 WP_001078309.1.97955 WP_001078309.1.97967 WP_001078309.1.97974 WP_001078309.1.97997 WP_001078309.1.97999 WP_001078309.1.98008 WP_001078309.1.98011 WP_001078309.1.98033 WP_001078309.1.98051 WP_001078309.1.98054 WP_001078309.1.98058 WP_001078309.1.98073 WP_001078309.1.98077 WP_001078309.1.98131 WP_001078309.1.98161 WP_001078309.1.98174 WP_001078309.1.98179 WP_001078309.1.98195 WP_001078309.1.98233 WP_001078309.1.98242 WP_001078309.1.98248 WP_001078309.1.98249 WP_001078309.1.98281 WP_001078309.1.98295 WP_001078309.1.98307 WP_001078309.1.98322 WP_001078309.1.98328 WP_001078309.1.98352 WP_001078309.1.98353 WP_001078309.1.98359 WP_001078309.1.98360 WP_001078309.1.98361 WP_001078309.1.98366 WP_001078309.1.98372 WP_001078309.1.98379 WP_001078309.1.98387 WP_001078309.1.98394 WP_001078309.1.98409 WP_001078309.1.98411 WP_001078309.1.98415 WP_001078309.1.98419 WP_001078309.1.98425 WP_001078309.1.98456 WP_001078309.1.98497 WP_001078309.1.98501 WP_001078309.1.98506 WP_001078309.1.98510 WP_001078309.1.98512 WP_001078309.1.98533 WP_001078309.1.98552 WP_001078309.1.98585 WP_001078309.1.98586 WP_001078309.1.986 WP_001078309.1.98609 WP_001078309.1.98655 WP_001078309.1.98659 WP_001078309.1.98667 WP_001078309.1.98703 WP_001078309.1.98706 WP_001078309.1.9872 WP_001078309.1.98723 WP_001078309.1.98730 WP_001078309.1.98734 WP_001078309.1.98741 WP_001078309.1.98750 WP_001078309.1.98767 WP_001078309.1.98786 WP_001078309.1.98797 WP_001078309.1.98821 WP_001078309.1.98825 WP_001078309.1.98837 WP_001078309.1.98842 WP_001078309.1.98858 WP_001078309.1.98865 WP_001078309.1.98874 WP_001078309.1.98880 WP_001078309.1.98883 WP_001078309.1.98894 WP_001078309.1.98924 WP_001078309.1.98967 WP_001078309.1.98978 WP_001078309.1.98985 WP_001078309.1.99009 WP_001078309.1.99025 WP_001078309.1.9903 WP_001078309.1.99090 WP_001078309.1.9910 WP_001078309.1.9912 WP_001078309.1.99136 WP_001078309.1.99155 WP_001078309.1.99171 WP_001078309.1.99183 WP_001078309.1.99195 WP_001078309.1.99207 WP_001078309.1.99217 WP_001078309.1.99237 WP_001078309.1.99249 WP_001078309.1.99262 WP_001078309.1.99280 WP_001078309.1.99283 WP_001078309.1.99308 WP_001078309.1.99311 WP_001078309.1.99359 WP_001078309.1.9936 WP_001078309.1.99394 WP_001078309.1.99405 WP_001078309.1.99414 WP_001078309.1.99418 WP_001078309.1.99430 WP_001078309.1.99459 WP_001078309.1.99492 WP_001078309.1.99494 WP_001078309.1.99509 WP_001078309.1.99519 WP_001078309.1.99523 WP_001078309.1.99524 WP_001078309.1.99525 WP_001078309.1.99536 WP_001078309.1.99538 WP_001078309.1.99564 WP_001078309.1.99569 WP_001078309.1.9960 WP_001078309.1.99631 WP_001078309.1.99638 WP_001078309.1.9965 WP_001078309.1.99683 WP_001078309.1.99686 WP_001078309.1.99688 WP_001078309.1.99700 WP_001078309.1.99714 WP_001078309.1.99759 WP_001078309.1.99768 WP_001078309.1.99777 WP_001078309.1.99802 WP_001078309.1.99830 WP_001078309.1.99849 WP_001078309.1.9985 WP_001078309.1.99850 WP_001078309.1.99859 WP_001078309.1.99860 WP_001078309.1.99862 WP_001078309.1.9987 WP_001078309.1.99884 WP_001078309.1.99888 WP_001078309.1.99901 WP_001078309.1.99926 WP_001078309.1.99934 WP_001078309.1.99950 WP_001078309.1.99954 WP_001078309.1.99955 WP_001078309.1.99956 WP_001078309.1.99963 WP_001078309.1.99979 WP_001078309.1.99984 WP_001078309.1.99985 WP_001078309.1.99999 YP_500918.1.76163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]