SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32470568|ref|NP_863238.1| from Staphylococcus epidermidis ATCC 12228

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32470568|ref|NP_863238.1|
Domain Number 1 Region: 387-474
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000373
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32470568|ref|NP_863238.1|
Sequence length 483
Comment sulfate permease [Staphylococcus epidermidis ATCC 12228]
Sequence
MVEKLKSEWFNQPRKNILAGIVVALALIPEAIAFSIIAGVDPMVGLYAAFIIATVTAIVG
GRPAMISGATGAVALLVTPLVKEHGVEYLFAATILMGLIQLLLGILKVGRLMKFIPRPVM
IGFVNALGIMIFMSQIEHIFNISIATYIYVIITLLIVYVIPRFYKAIPAPLIAIIVLTAL
YMYTGSDVRTVGDLGNIKQTLPHFLIPNIPFNLETLQIIFPYSLSMAIVGLVESLLTAKI
VDDATDTHSSKNKESRGQGIANIITGFFGGMGGCAMIGQSVINVKSGANSRLSTFTAGIV
LMFMIIVLGGVVVQIPMPILAGIMVMVSIGTVDWNSFKYIKKAPKTDAFVMVLTVIIVLI
THNLAIGVVVGVVFSAIFFATKISKVEVIYKELGKQHRFSFKGQIFFVSIDSMMEKIDFN
IEDSVIVLNFDHAHLWDDSAVNAIDTIVRKFEEKNNVVYVEKLNADSRKIISELSYLNET
HLN
Download sequence
Identical sequences A0A0H2VJ01
gi|32470568|ref|NP_863238.1| NP_863238.1.96214 WP_011117523.1.67262 gi|32470568|ref|NP_863238.1|NC_005005 176280.SE_p413 APC63874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]