SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28895939|ref|NP_802289.1| from Streptococcus pyogenes SSI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28895939|ref|NP_802289.1|
Domain Number 1 Region: 88-223
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-19
Family GntR ligand-binding domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 13-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000642
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28895939|ref|NP_802289.1|
Sequence length 231
Comment transcriptional regulator [Streptococcus pyogenes SSI-1]
Sequence
MNPIIEAVKQNLDLSRNLPLKIAFYNALKKTIILRQIPVGSRINEKEFSIALNISRTPIR
YALGLLSEEHLVEHIPKKGIIVKGVSIKDACEIFEIRKALETLATVQAMHLMTEEDFKVM
HNLLEDCETFIAEDDTNRILDNFNAFNNLIYSYSQMVRLKEIVTELQTYLVYFRKISISS
VERRKRALSEHWMIYRGMKNKDHEQITLITHEHLNSSLEFILKEMRPEQND
Download sequence
Identical sequences A0A0E1EN51 A0A0H2UUQ8
gi|21910363|ref|NP_664631.1| 193567.SPs1027 198466.SpyM3_0827 gi|28895939|ref|NP_802289.1| WP_011054507.1.11114 WP_011054507.1.12676 WP_011054507.1.13094 WP_011054507.1.13655 WP_011054507.1.16883 WP_011054507.1.17594 WP_011054507.1.17618 WP_011054507.1.22587 WP_011054507.1.23854 WP_011054507.1.26201 WP_011054507.1.27102 WP_011054507.1.30461 WP_011054507.1.31126 WP_011054507.1.34145 WP_011054507.1.34154 WP_011054507.1.3577 WP_011054507.1.35803 WP_011054507.1.41087 WP_011054507.1.42545 WP_011054507.1.47933 WP_011054507.1.49308 WP_011054507.1.51625 WP_011054507.1.5275 WP_011054507.1.52963 WP_011054507.1.53322 WP_011054507.1.53936 WP_011054507.1.55521 WP_011054507.1.59543 WP_011054507.1.60446 WP_011054507.1.62548 WP_011054507.1.62966 WP_011054507.1.6385 WP_011054507.1.64903 WP_011054507.1.66918 WP_011054507.1.67715 WP_011054507.1.67764 WP_011054507.1.71714 WP_011054507.1.72664 WP_011054507.1.7367 WP_011054507.1.74272 WP_011054507.1.74440 WP_011054507.1.74742 WP_011054507.1.74766 WP_011054507.1.75067 WP_011054507.1.77602 WP_011054507.1.81317 WP_011054507.1.81523 WP_011054507.1.84495 WP_011054507.1.86569 WP_011054507.1.87367 WP_011054507.1.89339 WP_011054507.1.89609 WP_011054507.1.92241 WP_011054507.1.92885 WP_011054507.1.95191 WP_011054507.1.95441 WP_011054507.1.97674 WP_011054507.1.99981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]