SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29827827|ref|NP_822461.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29827827|ref|NP_822461.1|
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily DhaL-like 8.76e-54
Family DhaL-like 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29827827|ref|NP_822461.1|
Sequence length 199
Comment dihydroxyacetone kinase subunit 2 [Streptomyces avermitilis MA-4680]
Sequence
MLDADFFRRWMTATAASVDREAERLTALDSPIGDADHGSNLQRGFHAVAVTLEKEAPDTP
GAVLVLAGRQLISTVGGASGPLYGTLLRRTGKELGDTAEVTEEQLTDALRAGVDAVMQLG
GAAPGDKTMIDALVPAVDALSDSFAAGRAAAEEGAVATTPLQARKGRASYLGERSIGHQD
PGATSSALLIAALEEASVE
Download sequence
Identical sequences Q82NL7
gi|29827827|ref|NP_822461.1| 227882.SAV_1286 WP_010982724.1.19017 WP_010982724.1.30226 WP_010982724.1.49792 WP_010982724.1.60620 WP_010982724.1.68722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]