SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29828238|ref|NP_822872.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29828238|ref|NP_822872.1|
Domain Number - Region: 131-201
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00024
Family PriA-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29828238|ref|NP_822872.1|
Sequence length 338
Comment hypothetical protein SAV_1696 [Streptomyces avermitilis MA-4680]
Sequence
MGDAVELEAAGRTVRLSSPDKIFFPERGFTKLDVAQYYLAVGDGILRALRNRPTTLERYP
DGMSGESFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEVAAVVWAAQFGTLTFHPWP
VRRDDVDHPDELRLDLDPQPGTDYADAVRAAHELRAVLHEYGDLRGWPKTSGGRGLHVFV
PIERRWTFTQVRRAAIAAGRELERRMPDQVTTAWWKEERGEKIFVDYNQTARDRTIASAY
SVRPRPHAPVSAPLRWDEVGDARPRDFDIATMPRRYAELGDVHADMDDHAFSLEALLELA
DRDEHDHGLGDLPYPPEYPKMPGEPKRVQPSRAKHGDG
Download sequence
Identical sequences Q82MG4
227882.SAV_1696 WP_010983135.1.19017 WP_010983135.1.30226 WP_010983135.1.49792 WP_010983135.1.60620 WP_010983135.1.68722 gi|29828238|ref|NP_822872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]