SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29829195|ref|NP_823829.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29829195|ref|NP_823829.1|
Domain Number - Region: 79-181
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00248
Family Bifunctional DNA primase/polymerase N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29829195|ref|NP_823829.1|
Sequence length 220
Comment hypothetical protein SAV_2653 [Streptomyces avermitilis MA-4680]
Sequence
MGFTIGGTRGIREIRPGARRRGRSSECTAVAEYTGLWGWDVVAGARAAAGACSCGRAECV
RPGAHPLDFATPLPAGATLDEVTEAWAEVPGAAVLLPVGRAFDVIEVAEAAGRHALVRLE
RMGLPLGPVTATPDGRAHFFVAPGAAAELPELLYRMAWDDTSLDLRALGPGTYITAPPSD
LGGLGPVRWLRSPALDSATNPPAARLLLGTLAYVAHRSRA
Download sequence
Identical sequences Q82JV1
WP_010984087.1.19017 WP_010984087.1.30226 WP_010984087.1.49792 WP_010984087.1.60620 WP_010984087.1.68722 gi|29829195|ref|NP_823829.1| 227882.SAV_2653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]