SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29829420|ref|NP_824054.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29829420|ref|NP_824054.1|
Domain Number 1 Region: 234-502,562-606
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-84
Family Type II chitinase 0.00000367
Further Details:      
 
Domain Number 2 Region: 30-132
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.58e-32
Family Cellulose-binding domain family II 0.00026
Further Details:      
 
Domain Number 3 Region: 141-223
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-16
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 4 Region: 504-563
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000759
Family Chitinase insertion domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29829420|ref|NP_824054.1|
Sequence length 607
Comment chitinase C precursor [Streptomyces avermitilis MA-4680]
Sequence
MRFGHRAVAGFATLLLPLAGLVGLASPAQAAGSATATYAKTQDWGTGFEGKWTVKNTGTS
SISSWTVEWDFPSGTSVTSAWDADVTSSGTHWTAKNKSWNGTLAPGASVSFGFNGAGSGS
PSNCKLNGDSCDGATTPGDAAPSAPGTPTASGITDTSAKLSWTAATDDKGVKNYDVLRDG
AKVATVTTTSYTDTGLTAGTDYSYTVQARDTADQTGPVSGAVAVHTTGGGTTPPPTGSAV
KLGYFTEWGIYGRNYNVKNLVTSGSASKITHINYAFGNVTGGKCAIGDSYADYDKAFTAD
QSVSGVADTWDQPLRGNFNQLRQLKAKYPNIKVLWSFGGWTWSGGFGAAAANPAAFAQSC
YDLVEDPRWADVFDGIDIDWEYPNACGLSCDTSGSAAYKNLMSALRAKFGSNNLVTAATT
ADGSSGGKIDAADYAGAAQYVDWYNVMTYDFFGAWDAQGPTAPHSPLTSYSGIPKAGFTT
ADAMAKFKAKGVPASKLLIGIGFYGRGWTGVTQDAPGGTATGPAAGTYEQGIEDYKVLKT
SCPATGTIAGTAYAHCGSNWWSYDTPATIGTKMAWAKSQGLGGAFFWEFSGDTGNGELVS
AINSGLG
Download sequence
Identical sequences Q82J87
gi|29829420|ref|NP_824054.1| WP_010984310.1.19017 WP_010984310.1.30226 WP_010984310.1.49792 WP_010984310.1.60620 WP_010984310.1.68722 227882.SAV_2878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]