SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29830121|ref|NP_824755.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29830121|ref|NP_824755.1|
Domain Number - Region: 30-88
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0267
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29830121|ref|NP_824755.1|
Sequence length 95
Comment hypothetical protein SAV_3578 [Streptomyces avermitilis MA-4680]
Sequence
MSDLQREVTDLESKSATAARLFDIRRIIGGLFVVYGIIVTIAGISPSDADLDKAQGVNIN
LWTGLGMLALGLFFLGWMWLRPTVPPTPADEEPSQ
Download sequence
Identical sequences Q82HD1
GO.9719 WP_010985009.1.19017 WP_010985009.1.30226 WP_010985009.1.49792 WP_010985009.1.60620 WP_010985009.1.68722 227882.SAV_3578 gi|29830121|ref|NP_824755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]