SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29830255|ref|NP_824889.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29830255|ref|NP_824889.1|
Domain Number - Region: 11-157
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00163
Family Bifunctional DNA primase/polymerase N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29830255|ref|NP_824889.1|
Sequence length 286
Comment hypothetical protein SAV_3712 [Streptomyces avermitilis MA-4680]
Sequence
MTQPTDIRTEHLATALSLAASGIPVLPLRAGKVPFGNCHRCTDNACGGRPNMKNAGPCAC
PGPCHAWAAATTDPDVIQSGVWRRAWMRASAVAYHPGGAWLTVVDLDNAEAVTWARETLP
ATQTVPTTRGEHWIYLGPMQSTNAVRPGVDIKSTMAYARYLGPGTGRMAALPDAVRALTV
KNPTTARPAPQAITVPALAGGGECRHRTPTYLERGIAMAEQRITAASSAVHATVYRTFLA
VLSTHGRCGCLTDTHMARLFAAAQAKGESARHCTDAWTNARTRLGL
Download sequence
Identical sequences Q82H34
WP_010985143.1.19017 WP_010985143.1.30226 WP_010985143.1.49792 WP_010985143.1.60620 WP_010985143.1.68722 227882.SAV_3712 gi|29830255|ref|NP_824889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]