SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29830764|ref|NP_825398.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29830764|ref|NP_825398.1|
Domain Number 1 Region: 24-107
Classification Level Classification E-value
Superfamily Prim-pol domain 0.0000000634
Family Bifunctional DNA primase/polymerase N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29830764|ref|NP_825398.1|
Sequence length 118
Comment hypothetical protein SAV_4221 [Streptomyces avermitilis MA-4680]
Sequence
MTQPANVRRDPALPISTDLTRLGLLAWATQTAQRGRHVIPLRPNDKRPAGHAEQYCPATG
RCADGHKTPEQRATTDVELLIAAWAQAPYNVRIATGPSGLRVIDLDGSIRTARPREAA
Download sequence
Identical sequences Q82FN1
gi|29830764|ref|NP_825398.1| WP_010985648.1.19017 WP_010985648.1.30226 WP_010985648.1.49792 WP_010985648.1.60620 WP_010985648.1.68722 227882.SAV_4221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]