SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29831113|ref|NP_825747.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29831113|ref|NP_825747.1|
Domain Number 1 Region: 296-433
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 9.42e-30
Family Oxidoreductase molybdopterin-binding domain 0.00063
Further Details:      
 
Weak hits

Sequence:  gi|29831113|ref|NP_825747.1|
Domain Number - Region: 60-200
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.000811
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29831113|ref|NP_825747.1|
Sequence length 434
Comment hypothetical protein SAV_4570 [Streptomyces avermitilis MA-4680]
Sequence
MGCGPFRGVVPAYLRDMRAPRLPSSRAPWLPSSPGFWRSPVRGPWFTSVLGVVLLGGITV
LFVTGLLSYAAYNPDLAPVNDQTPDKGLLGFYLFAWPTDPPWLYRLTQGLHVTLGLTLIP
VLLAKLWSVVPKLFELPPARSLAHALERLSLLLLVGGALFEFVTGVLNVQLDYVFPGSFY
PLHFYGAWVFFAAFVAHAVLKTPAALRNLRRPRTEEEEYEPGSPPRAEPTVSRRGALGLV
GGGSLLLFGTTAGHSFDGPLRQTAVLAPHGGPEPGPGPGGFQINKTAAYAGIDDRETSAD
AWRLVLVGRTGTVRLSRAELERLPSRSSALPIACVEGWSTSDQRWRGVRLRDLAALVGHD
EPPDVLVESLQRHGAFRRAALRANQVADPRSLLALYVNGEALTPDHGHPARIIVPAAPGV
LNTKWVARMTFGDL
Download sequence
Identical sequences Q82EP4
gi|29831113|ref|NP_825747.1| WP_010985994.1.19017 WP_010985994.1.30226 WP_010985994.1.49792 WP_010985994.1.60620 WP_010985994.1.68722 227882.SAV_4570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]