SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29832734|ref|NP_827368.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29832734|ref|NP_827368.1|
Domain Number 1 Region: 85-292
Classification Level Classification E-value
Superfamily Rhomboid-like 4.58e-36
Family Rhomboid-like 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|29832734|ref|NP_827368.1|
Domain Number - Region: 23-63
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000449
Family B-box zinc-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29832734|ref|NP_827368.1|
Sequence length 321
Comment hypothetical protein SAV_6192 [Streptomyces avermitilis MA-4680]
Sequence
MEPKSPESPETPDSPESPESADSAVTTCYRHPKVESHVRCIRCDRYICPDCMREASVGHQ
CVECVKEGARSVRQARTAFGGRITTAPLVTYVLIGLNVLAYLGEVLRPALVDRFQMLGAG
LAGPDGGHYLWQDPYPSSFHAEGVVGGEWERLLTGAFLHLPPTEGTFGILHIVMNMVSLW
NLGRVVEAQLGRVRFLALYLLSALGGSVLVLLIAPDTPTVGASGAIFGLGAAYYVMARRL
GADMRAVNRFIAGLLLWLLISAGLTSWQGHLGGLLAGGLVTLAYAYVPRGPRRGLLQAAA
CVGLLALLLVLTVGKVSGLTG
Download sequence
Identical sequences Q82A67
227882.SAV_6192 WP_010987593.1.19017 WP_010987593.1.30226 WP_010987593.1.49792 WP_010987593.1.60620 WP_010987593.1.68722 gi|29832734|ref|NP_827368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]