SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29833460|ref|NP_828094.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29833460|ref|NP_828094.1|
Domain Number 1 Region: 58-326,386-424
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.64e-81
Family Type II chitinase 0.00000367
Further Details:      
 
Domain Number 2 Region: 328-387
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000137
Family Chitinase insertion domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29833460|ref|NP_828094.1|
Sequence length 427
Comment chitinase [Streptomyces avermitilis MA-4680]
Sequence
MLSPHRPRVLPQTRKPVRTGGASLRALLSAACCAVLGAGLLAGAGTATATEAQAPARAAA
AGSKVVGYFTEWGTYDRKYYVKNIETSGSGAKLTHINYAFGNVTGGKCAMGDAYAATDRA
YTAAESVDGVADTWDQPLRGNFNQLRKLKKLHPNLKVLWSFGGWTWSSGFGEAAKNPAAF
AQSCYDLVENSKWADVFDGIDIDWEYPNACGNTCDTSGKAAYKNLMGALRSKFGSGNLVT
SAITADATSGGKIDAADYAGAAQYVDWYNPMTYDFFGAWDATGPTAPHSPLNSYSGIPKA
GYHTSATIAKLRGLGVPASKLLLGIGFYGRGWTGVTQAAPGGSATGPAAGTYEQGIDDYK
VLKTKCPATGTVGGTAYAKCGSNWWSYDTPSTIAGKMTYKNAQGLGGTFFWELSGDTSNG
ELIKAIN
Download sequence
Identical sequences Q827K6
227882.SAV_6918 gi|29833460|ref|NP_828094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]