SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29828710|ref|NP_823344.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29828710|ref|NP_823344.1|
Domain Number 1 Region: 31-210
Classification Level Classification E-value
Superfamily E set domains 4.48e-43
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29828710|ref|NP_823344.1|
Sequence length 311
Comment cellulose-binding protein [Streptomyces avermitilis MA-4680]
Sequence
MTAHRTAAAAAVAVAAPLLLTAWAAGPAQAHGAPTDPVSRVVACSPEGGGRARTAACTAA
IAANGSPFTAWDNLRVAGVNGRDRQLIPDGKLCSGGLPAYKGLDLTRSDWPSTRLTPGAS
LTMKYSSTIPHTGTFKLYLTKQGYDPTKPLTWSDLPAQPFAQLKDPALAGGAYRLGAKLP
ADRTGRHVLFTIWQNTSTTDTYYSCSDVVFAKAKAAAGAGGGSTGAARKPAGKATPSSPA
ATSSPSSSPSPSRSETAASTPPPSRTAVPGTPAAATAHRSDSGPSLPLLAGGAAAVVLAA
GAVVSLRRRRR
Download sequence
Identical sequences Q82L44
227882.SAV_2168 gi|29828710|ref|NP_823344.1| WP_010983608.1.19017 WP_010983608.1.30226 WP_010983608.1.49792 WP_010983608.1.60620 WP_010983608.1.68722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]