SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29830881|ref|NP_825515.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29830881|ref|NP_825515.1|
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-78
Family Protein kinases, catalytic subunit 0.0000000364
Further Details:      
 
Domain Number 2 Region: 445-503
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 510-572
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000981
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|29830881|ref|NP_825515.1|
Domain Number - Region: 378-439
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00089
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number - Region: 578-635
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29830881|ref|NP_825515.1|
Sequence length 667
Comment serine/threonine protein kinase [Streptomyces avermitilis MA-4680]
Sequence
MEEPRRLGGRYELGHVLGRGGMAEVHLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYIEGISIPYIVMEYVDGSTLRELLHSGRKLLPERTLEMTI
GILQALEYSHRAGIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQPPSVFD
PEITPEMDAIVLKALTKDPDYRYQSADEMRIDIEACLDGQPVAATAAMGSVGYNGYGDDQ
ATTALRADAGATTMLPPMNPDDGGFGFDDRPDRRRQRDQKKSNTSTILLVVAGALVLIGA
ILIGKWIFDGDRAANDTVPAPNFVGLTLADAKQQAVNGDVKLSITKKPCEDQAKGNVCSQ
SPDAKTKVKKNSLVNLVLSTGAPKIAVPDVTGLTFGKAKSQLEDKGFRVEKKTEVSDQTP
GVVTAQDPSGDSERQKGTTITLTVAAEAQKVTVPDVTGKSCDEAKQQMQANNLTGNCTEV
DTSDASQAGKVIQTSPTAGTEVKKNSAVDIQVGKAPQQVAVPNLGGQSLKDAKKALQDAG
LNVGNITGSQDDNAIVIASDPQAGTQVAQGTAVNLTAAGGNNNNGGNNNGGTTFFGGATG
TAFRTED
Download sequence
Identical sequences Q81ZX9
NYSGRC-FDAO-BAC72050 SvR534 WP_010985763.1.19017 WP_010985763.1.30226 WP_010985763.1.49792 WP_010985763.1.60620 WP_010985763.1.68722 227882.SAV_4338 gi|29830881|ref|NP_825515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]