SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29832201|ref|NP_826835.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29832201|ref|NP_826835.1|
Domain Number 1 Region: 458-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000451
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29832201|ref|NP_826835.1|
Sequence length 705
Comment transmembrane sulfate transport protein [Streptomyces avermitilis MA-4680]
Sequence
MSGSHARGRVPAHTRTAAKTVTKTATKTATKTATDAATETVPETATRTAPKAGAKADLGT
EITASLVVFLVALPLCIGVAVASGVPAELGIISGVIGGLVVGAARGSTLQVSGPAAGLAA
LVSETVLEHGVAMLGVIVLGSGILQIVLGLVRLGRLFQAISLAVVQGMLAGIGLPLMFSQ
AYPMADTKAPGTPIENMAGIPGLLGETVTHPQAAIAALLGIVTIVLSFLWKKMPGPVKKI
PAALVAVGIGIAVAALPGVNVKTLQVGNLPAAVRMPGPEQFAGLADAAIISSVLTFTVIA
SAESLFTAAAVDRMHSGPRTRYNAELIAQGAGNTVAGILGALPITAVVARSSANVQAGAT
TRLSRVLHGLWLLAFALLLPQVLALIPISVLAGVLVHSGWKLFAPEEFPKMWRQDRGEFA
VMTLTTLVIVATALLEGVLIGLAAGIVLAALRMSQTVIRQHLDEDTAKVVMAGNATFLRL
PQVIEALEAAAASGRPRIRLDLTGVTHLDHACRNQVEDFTAQQRGLGLRVELLMPGPAKA
GPAETGPVGRAGAMASAPGSGGADTPSARDSGAGAMTSASGAWAQAAAPGSWTEASAPGS
WEEARTSGSWEEARPPASPPAGAAGAAESFRQGYRHGSRGYRTAPLPRRRRAAAPVEESA
PVEAPAMAEAPATAEAPAPAPSPTAEWFYLDTSLSDPDDCAGRLG
Download sequence
Identical sequences Q82BP6
gi|29832201|ref|NP_826835.1| 227882.SAV_5658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]