SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433591986|ref|YP_007281482.1| from Natrinema pellirubrum DSM 15624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433591986|ref|YP_007281482.1|
Domain Number 1 Region: 451-589,1002-1232,1265-1307
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.75e-81
Family DNA polymerase I 0.00014
Further Details:      
 
Domain Number 2 Region: 63-462
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.62e-65
Family DnaQ-like 3'-5' exonuclease 0.00021
Further Details:      
 
Domain Number 3 Region: 588-695
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.19e-20
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.021
Further Details:      
 
Domain Number 4 Region: 881-963
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000000264
Family Intein endonuclease 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433591986|ref|YP_007281482.1|
Sequence length 1321
Comment DNA polymerase elongation subunit (family B) [Natrinema pellirubrum DSM 15624]
Sequence
MTEAGQTGLTEFGGDSEAADDRPEEEAVAVAGNGGSDAAEVIDVVEETLPESEGDLELAV
MQVDYTIVGYGDEERPIMHVFGRTPDEELEHVQIVGFKPYFYAPTESLERPPAEEYDRLT
GSREYDHDGDPYESIRGERLTKIFGQTPRDVGQVRDDFEHYEADILFPNRFLIDKDIRSG
MRVPERRAEDDSLVVPHDEVEPVDVDADPRINTFDIEVDDRSGFPEDGEEPIVCLTSHDS
YRDEYVMWLYEAPIGDGETPAEIDDYDPIEGEIDHEVRSFEEEEAMLEAFIEYVDETDPD
VLTGWNFEDFDAPYFLDRLEELAGSHHEYDLSIDRLSRVDEVWRSNWGGPDIKGRVVFDL
LYGYQRMVFSELDSYRLDAVGEAELGVGKERYAGDIGDLWEEDPTQLLAYNLRDVELCVE
LDRQQEIIPFWDEVRAFVGCKLEDAPTPGDAVDMYVLHEAHGRFALPSKGQQEAGEEYEG
GAVFEPITGVKENVTVLDLKSLYPMCMTTINASPETKVDPDEYDGETYVAPTGTHFRKEP
DGVNREMITELLAEREEKKELRDQHEPGSPEYEQYDRQQGAVKVIMNCFTPDTEVLTPNG
VRDITDLEVGDEVYSLDPETEELEVKPVVETHDYPDYDGDLIDIETSKIDFRVTPNHRML
VRKNETNGITEDEYGFVEAGDLDRATNYELPHDWDGPGGEELAEVDLTELIDGEYEVWVR
PSVHGRTFTAELGWTPRRVPKADIGKTGYVFTAEEFEEHREYIESVCETSFVHRESGRKW
IPRTYDGDDFLDLLAWFVTEGNVYTSEDKQFGENFRGSATKIQLAQEKLPMTDGGGNHHA
TIGELLDDMGFDYYVDDRSYSVTSKLLGNLLRSLCGDGSFEKRIPEFVFDCSRRQKRRFL
EGLIDGDGDRQVNSWRYSTSSDRLRDDVLRLCAHLGLTANYSRDSGTWRIYVTEESKNTL
RMHRSSSRSTAENGVYCVTVEDNHTLLAGRNGKFQFVGQSLYGVSGWEQFRLYDKEAASA
ITATGREVIEFTDSAAQELDYQVTYGDTDSVMLELGPDVPKEEALEQSFEIEEYINGRYD
DFAKDDLNAEFHRFQIEFEKLYRRFFQAGKKKRYAGHITWKEGKDVNDVDIVGFEYQRSD
IAPITKEVQHRVIEMIVREGDIEGAKEYVNGVIEDVLAGEISLEEIAIPGGIGKRLDNYD
TDTAQVRGAKYANLLLGTNFQRGSKPKRLYLERVDPSFFERLEAEEGFDARTDPLYGAFK
RDPDVICFEYEDQIPEAFAVDYEKMLEKTLQGPIERILEALDISWDEVKNGQEQKGLDSF
M
Download sequence
Identical sequences L0JP03
gi|433591986|ref|YP_007281482.1| WP_006181961.1.15549 WP_006181961.1.24189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]