SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433592794|ref|YP_007282290.1| from Natrinema pellirubrum DSM 15624

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|433592794|ref|YP_007282290.1|
Domain Number - Region: 166-210
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000272
Family MJ1460-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|433592794|ref|YP_007282290.1|
Sequence length 211
Comment V4R domain-containing protein [Natrinema pellirubrum DSM 15624]
Sequence
MATLNSWIKRLVGSADEESQSSDELQAVDDRIGFEASLEDAEVIGRSPLSYIAAGESISS
FVGKQITSKLAEYGLEEIEPDEWYPLQVPLAMLYDMRDEYGDVRMRNMGQNVPEHVEFPP
DLSEVDNALRAIDTAYHQNHRGSEIGSYEFQQEGPNAGVMTCENPYPCEFDKGLIKGVAK
KFADNPVQVEEVGDQCRSDGDHRCEYRVEWL
Download sequence
Identical sequences L0JSP2
gi|433592794|ref|YP_007282290.1| WP_006182854.1.15549 WP_006182854.1.24189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]