SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433592846|ref|YP_007282342.1| from Natrinema pellirubrum DSM 15624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433592846|ref|YP_007282342.1|
Domain Number 1 Region: 13-244
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.17e-54
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000299
Further Details:      
 
Domain Number 2 Region: 333-494,739-805
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.04e-41
Family Intein (protein splicing domain) 0.026
Further Details:      
 
Domain Number 3 Region: 287-356,808-1095
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.89e-26
Family Extended AAA-ATPase domain 0.012
Further Details:      
 
Domain Number 4 Region: 571-668
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000567
Family Intein endonuclease 0.076
Further Details:      
 
Domain Number 5 Region: 680-731
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000394
Family SinR domain-like 0.031
Further Details:      
 
Domain Number 6 Region: 481-552
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000351
Family Intein endonuclease 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433592846|ref|YP_007282342.1|
Sequence length 1172
Comment putative ATPase involved in replication control, Cdc46/Mcm family [Natrinema pellirubrum DSM 15624]
Sequence
MAQAGNSELVDSFEQFFRNYYDSEIKQLAQQYPNEQRSLHVDWQDLYRFDPDLADDFINQ
PEQLQRYAEEALRLYDLPIDVSLGQAHVRVRNLPETESPEIREIRARDMNSLVQVHGIVR
KATDVRPKIEEAAFECQLCGTLTRVPQSSGDFQEPHECQGCERQGPFRVNFDQSEFVDSQ
KLRVQESPEGLRGGETPQALDINIEDDITGEVTPGDHVSATGVLRLEQQGDQQDPSPVFD
FYMEGMSVEIDEEQFEDMDITGEDKEEIVRLSSSEDIYEKMVASIAPSIYGYDQEKLSMI
LQLFSGVTKQLPDGSRIRGDLHMLLIGDPGTGKCVRGDTKVTLADGRDVPIRDLVESNLD
NPKPIDDGWYDEIDIDVPSLQENGEIDPQRATKVWKREAPDRMYRLRTAGGRELEVTPSH
PLFVQQDGRFTPIVADELNEGQFIATPRSVETNSDDTLEVDFRRSKSRNAVQLDLPEKWT
PSLARLIGYIVAEGYVEQRDDQTGFVSITNNDREVLDDAANALADLGLNVTERDPHESKD
ARELLCSAGEFVSFLDTLAEQLLQSSDNQCVPDPIFRTTESIRSEFLKAFLEGEGHVSES
QREITAASTSRELLENVRTLLLSLGIRSQLHDRQNGSYRLRISGDEFEKYVSNIGFVTQR
KQRTARQYADTDGNTNLDIIPNLGTELRRIREALSITQAECGLPRSTYQHYERGSRNPSR
DSLRRVVSAFEDALPKSEHPNEGAVLTDGGTVAKDVTALKQFADGDICWERIESIDEVDP
DYDWVYDLEVDGTHNYISNGVVSHNSQMLAYIENIAPRAVYTSGKGSSSAGLTAAAVRDD
FGDGQQWSLEAGALVLADQGIAAIDELDKMRPEDRSAMHEALEQQKISVSKAGINATLKS
RCSLLGAANPKYGRFDQYEPISEQIDLEPALISRFDLIFTVTDTPDEEKDRNLAEHIITT
NYAGELTTQREEMSSLEVSQGEIDEMTDQVDPEIDAELLRKYIAYAKQNCHPRMTEAARN
AIRDFYVDLRSKGTDEDAAVPVTARKLEALVRLSEASARVRLSDTVEEADAERVIEIVRS
CLQDVGVDPETGEFDADIVEAGTSKSQRDRIKNLKQLIGDIEEEYDDGAPVDIVMERAEE
IGMDQSKAEHEIDKLKQKGEVYEPSTNTLRTT
Download sequence
Identical sequences L0JRJ6
gi|433592846|ref|YP_007282342.1| WP_006182906.1.15549 WP_006182906.1.24189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]