SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339998883|ref|YP_004729766.1| from Salmonella bongori NCTC 12419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339998883|ref|YP_004729766.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 2.22e-30
Family YccV-like 0.00000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339998883|ref|YP_004729766.1|
Sequence length 105
Comment hypothetical protein SBG_0880 [Salmonella bongori NCTC 12419]
Sequence
MIASKFGIGQQVRHSLLGYLGVVVDIDPEYSLDEPSPDELAVNDELRAAPWYHVVMEDDD
GQPVHTYLAEAQLRSEMRDEHPEQPSMDELARTIRKQLQAPRLRN
Download sequence
Identical sequences A0A0F5BD86 A0A0F6AZP3 A0A0F7DIA7 A0A0G2NL32 A0A0H3NBU1 A0A0J5F6J6 A0A0K0H9G1 A0A0L3J8Q1 A0A0M0PLC1 A0A0R9P0G0 A0A0T9X3J9 A0A0U1GWN1 A0A0V2DH83 A0A1C2ZTY9 A0A1J7LKS4 A0A1R2PS88 A0A1S0ZKR1 A0A1S1AMV8 A0A1X2RTU7 A0A1X2T6A9 A0A1X2UV66 A0A1X2Y2A8 A0A1Z3Q2S1 A0A221YJG6 A0A221Z1G8 A0A241SBZ4 A0A248KBR3 A0A265B8L4 A0A267SF22 A0A271CB01 A0A271CXS0 A0A2C6ENK1 A0A2C9P1E8 A0A2D1XFK8 A0A2D1XTE4 A0A2D3TXA2 A0A2G1P267 A0A2H9YAW0 A0A2I5HIC2 A0A2I6MA54 A0A2I6MMS1 A0A2I6N0X6 A0A2I6NF08 A0A2I6NSW3 A0A2I6P5N0 A0A2K3A9H4 A9N6W1 B4T208 B4TE05 B4TSJ1 B5F1W2 B5FR08 B5QZG9 B5R6D2 C0Q8C6 E8XE36 G4C0I0 G5QY47 M7RHN9 Q7CQT0 Q8XFC1 S4IP29 S5HK15 S5MNC3 V1H4T5 V1WUG8 V7IKG9 V7UTM6
gi|339998883|ref|YP_004729766.1| gi|378988426|ref|YP_005251590.1| gi|537437214|ref|YP_008481591.1| gi|549723721|ref|YP_008643911.1| NP_455577.1.84458 NP_460053.1.58477 WP_000561983.1.100002 WP_000561983.1.100007 WP_000561983.1.100008 WP_000561983.1.100010 WP_000561983.1.100017 WP_000561983.1.100031 WP_000561983.1.100036 WP_000561983.1.100077 WP_000561983.1.100079 WP_000561983.1.100115 WP_000561983.1.100129 WP_000561983.1.10013 WP_000561983.1.100137 WP_000561983.1.100149 WP_000561983.1.100165 WP_000561983.1.100191 WP_000561983.1.100196 WP_000561983.1.1002 WP_000561983.1.100234 WP_000561983.1.100258 WP_000561983.1.100266 WP_000561983.1.100284 WP_000561983.1.100288 WP_000561983.1.100313 WP_000561983.1.100314 WP_000561983.1.100321 WP_000561983.1.100354 WP_000561983.1.100376 WP_000561983.1.100392 WP_000561983.1.100412 WP_000561983.1.100413 WP_000561983.1.100421 WP_000561983.1.100424 WP_000561983.1.100432 WP_000561983.1.100436 WP_000561983.1.100438 WP_000561983.1.100446 WP_000561983.1.100450 WP_000561983.1.100457 WP_000561983.1.100472 WP_000561983.1.100484 WP_000561983.1.100488 WP_000561983.1.100502 WP_000561983.1.100519 WP_000561983.1.100521 WP_000561983.1.100541 WP_000561983.1.100557 WP_000561983.1.100584 WP_000561983.1.100589 WP_000561983.1.100592 WP_000561983.1.100597 WP_000561983.1.100605 WP_000561983.1.100610 WP_000561983.1.100642 WP_000561983.1.10065 WP_000561983.1.100650 WP_000561983.1.100707 WP_000561983.1.100711 WP_000561983.1.100714 WP_000561983.1.100721 WP_000561983.1.100730 WP_000561983.1.100732 WP_000561983.1.100733 WP_000561983.1.100739 WP_000561983.1.10074 WP_000561983.1.100750 WP_000561983.1.10076 WP_000561983.1.100764 WP_000561983.1.100773 WP_000561983.1.100776 WP_000561983.1.100781 WP_000561983.1.100790 WP_000561983.1.100793 WP_000561983.1.100799 WP_000561983.1.10081 WP_000561983.1.100857 WP_000561983.1.100865 WP_000561983.1.100869 WP_000561983.1.100870 WP_000561983.1.100871 WP_000561983.1.100882 WP_000561983.1.100886 WP_000561983.1.100895 WP_000561983.1.100932 WP_000561983.1.100941 WP_000561983.1.100944 WP_000561983.1.100948 WP_000561983.1.100953 WP_000561983.1.101007 WP_000561983.1.101011 WP_000561983.1.101020 WP_000561983.1.101042 WP_000561983.1.101074 WP_000561983.1.101078 WP_000561983.1.10108 WP_000561983.1.101088 WP_000561983.1.101091 WP_000561983.1.101094 WP_000561983.1.101112 WP_000561983.1.101123 WP_000561983.1.101126 WP_000561983.1.101147 WP_000561983.1.101180 WP_000561983.1.101185 WP_000561983.1.101199 WP_000561983.1.101223 WP_000561983.1.101226 WP_000561983.1.10124 WP_000561983.1.101259 WP_000561983.1.101271 WP_000561983.1.101284 WP_000561983.1.101291 WP_000561983.1.1013 WP_000561983.1.101312 WP_000561983.1.101320 WP_000561983.1.101322 WP_000561983.1.101353 WP_000561983.1.101374 WP_000561983.1.101386 WP_000561983.1.101404 WP_000561983.1.101420 WP_000561983.1.101425 WP_000561983.1.101454 WP_000561983.1.101473 WP_000561983.1.101519 WP_000561983.1.101520 WP_000561983.1.101541 WP_000561983.1.101543 WP_000561983.1.101589 WP_000561983.1.101609 WP_000561983.1.101612 WP_000561983.1.101616 WP_000561983.1.101634 WP_000561983.1.101636 WP_000561983.1.101639 WP_000561983.1.10164 WP_000561983.1.101666 WP_000561983.1.101674 WP_000561983.1.101707 WP_000561983.1.101724 WP_000561983.1.101734 WP_000561983.1.101740 WP_000561983.1.101741 WP_000561983.1.101744 WP_000561983.1.101759 WP_000561983.1.10177 WP_000561983.1.101776 WP_000561983.1.101815 WP_000561983.1.101832 WP_000561983.1.101839 WP_000561983.1.101841 WP_000561983.1.101868 WP_000561983.1.101878 WP_000561983.1.101890 WP_000561983.1.10191 WP_000561983.1.101917 WP_000561983.1.101927 WP_000561983.1.101941 WP_000561983.1.101949 WP_000561983.1.101953 WP_000561983.1.101975 WP_000561983.1.102009 WP_000561983.1.102050 WP_000561983.1.102087 WP_000561983.1.102103 WP_000561983.1.102111 WP_000561983.1.10220 WP_000561983.1.10231 WP_000561983.1.10237 WP_000561983.1.10266 WP_000561983.1.10276 WP_000561983.1.10293 WP_000561983.1.10300 WP_000561983.1.10310 WP_000561983.1.10338 WP_000561983.1.1038 WP_000561983.1.10394 WP_000561983.1.104 WP_000561983.1.10401 WP_000561983.1.10428 WP_000561983.1.10429 WP_000561983.1.10439 WP_000561983.1.10459 WP_000561983.1.10463 WP_000561983.1.10465 WP_000561983.1.10475 WP_000561983.1.10498 WP_000561983.1.10507 WP_000561983.1.10511 WP_000561983.1.10514 WP_000561983.1.10521 WP_000561983.1.10530 WP_000561983.1.10532 WP_000561983.1.10547 WP_000561983.1.10562 WP_000561983.1.10566 WP_000561983.1.10568 WP_000561983.1.10595 WP_000561983.1.106 WP_000561983.1.10631 WP_000561983.1.10642 WP_000561983.1.10654 WP_000561983.1.10675 WP_000561983.1.10677 WP_000561983.1.10678 WP_000561983.1.10711 WP_000561983.1.10720 WP_000561983.1.10753 WP_000561983.1.10755 WP_000561983.1.10797 WP_000561983.1.10857 WP_000561983.1.10868 WP_000561983.1.10873 WP_000561983.1.10898 WP_000561983.1.10926 WP_000561983.1.10936 WP_000561983.1.10992 WP_000561983.1.11000 WP_000561983.1.11012 WP_000561983.1.11024 WP_000561983.1.11031 WP_000561983.1.11041 WP_000561983.1.11055 WP_000561983.1.11098 WP_000561983.1.1110 WP_000561983.1.11119 WP_000561983.1.11126 WP_000561983.1.11142 WP_000561983.1.11156 WP_000561983.1.11168 WP_000561983.1.11190 WP_000561983.1.11213 WP_000561983.1.11216 WP_000561983.1.11239 WP_000561983.1.11253 WP_000561983.1.11254 WP_000561983.1.11295 WP_000561983.1.113 WP_000561983.1.11304 WP_000561983.1.11314 WP_000561983.1.1135 WP_000561983.1.11362 WP_000561983.1.11369 WP_000561983.1.1137 WP_000561983.1.11385 WP_000561983.1.11386 WP_000561983.1.11405 WP_000561983.1.1142 WP_000561983.1.11426 WP_000561983.1.11429 WP_000561983.1.11444 WP_000561983.1.11455 WP_000561983.1.11458 WP_000561983.1.11479 WP_000561983.1.1150 WP_000561983.1.11511 WP_000561983.1.11518 WP_000561983.1.11526 WP_000561983.1.11528 WP_000561983.1.11532 WP_000561983.1.11543 WP_000561983.1.11544 WP_000561983.1.11557 WP_000561983.1.1156 WP_000561983.1.11565 WP_000561983.1.11567 WP_000561983.1.11588 WP_000561983.1.11603 WP_000561983.1.11621 WP_000561983.1.11638 WP_000561983.1.11677 WP_000561983.1.11681 WP_000561983.1.11687 WP_000561983.1.1169 WP_000561983.1.11735 WP_000561983.1.1174 WP_000561983.1.11763 WP_000561983.1.11772 WP_000561983.1.11824 WP_000561983.1.11834 WP_000561983.1.11841 WP_000561983.1.11865 WP_000561983.1.11868 WP_000561983.1.11875 WP_000561983.1.11883 WP_000561983.1.11897 WP_000561983.1.11900 WP_000561983.1.11908 WP_000561983.1.11914 WP_000561983.1.11936 WP_000561983.1.11938 WP_000561983.1.11964 WP_000561983.1.11978 WP_000561983.1.12007 WP_000561983.1.12017 WP_000561983.1.12025 WP_000561983.1.12027 WP_000561983.1.12040 WP_000561983.1.12047 WP_000561983.1.12059 WP_000561983.1.12061 WP_000561983.1.12063 WP_000561983.1.1207 WP_000561983.1.12106 WP_000561983.1.12114 WP_000561983.1.12141 WP_000561983.1.12144 WP_000561983.1.1215 WP_000561983.1.12159 WP_000561983.1.12160 WP_000561983.1.12168 WP_000561983.1.12172 WP_000561983.1.12192 WP_000561983.1.1224 WP_000561983.1.12244 WP_000561983.1.12280 WP_000561983.1.12282 WP_000561983.1.1232 WP_000561983.1.12340 WP_000561983.1.12351 WP_000561983.1.12364 WP_000561983.1.12370 WP_000561983.1.12374 WP_000561983.1.1239 WP_000561983.1.12396 WP_000561983.1.12397 WP_000561983.1.12398 WP_000561983.1.12441 WP_000561983.1.12456 WP_000561983.1.1246 WP_000561983.1.12472 WP_000561983.1.12484 WP_000561983.1.12485 WP_000561983.1.1250 WP_000561983.1.12517 WP_000561983.1.12546 WP_000561983.1.12568 WP_000561983.1.12569 WP_000561983.1.12581 WP_000561983.1.12584 WP_000561983.1.12585 WP_000561983.1.12620 WP_000561983.1.1264 WP_000561983.1.12648 WP_000561983.1.12650 WP_000561983.1.12683 WP_000561983.1.12696 WP_000561983.1.12701 WP_000561983.1.12718 WP_000561983.1.12726 WP_000561983.1.12727 WP_000561983.1.12728 WP_000561983.1.12741 WP_000561983.1.12834 WP_000561983.1.12864 WP_000561983.1.12877 WP_000561983.1.12879 WP_000561983.1.12936 WP_000561983.1.1299 WP_000561983.1.12995 WP_000561983.1.1300 WP_000561983.1.13027 WP_000561983.1.13076 WP_000561983.1.13101 WP_000561983.1.13102 WP_000561983.1.13106 WP_000561983.1.13108 WP_000561983.1.13130 WP_000561983.1.13161 WP_000561983.1.13207 WP_000561983.1.1321 WP_000561983.1.13247 WP_000561983.1.1326 WP_000561983.1.13268 WP_000561983.1.13274 WP_000561983.1.13291 WP_000561983.1.133 WP_000561983.1.13311 WP_000561983.1.13314 WP_000561983.1.13334 WP_000561983.1.13338 WP_000561983.1.13342 WP_000561983.1.13352 WP_000561983.1.13367 WP_000561983.1.13391 WP_000561983.1.13406 WP_000561983.1.13414 WP_000561983.1.13429 WP_000561983.1.13440 WP_000561983.1.13443 WP_000561983.1.13446 WP_000561983.1.1346 WP_000561983.1.13476 WP_000561983.1.13488 WP_000561983.1.13509 WP_000561983.1.13528 WP_000561983.1.13543 WP_000561983.1.13573 WP_000561983.1.13599 WP_000561983.1.13625 WP_000561983.1.13661 WP_000561983.1.13669 WP_000561983.1.13677 WP_000561983.1.13686 WP_000561983.1.13691 WP_000561983.1.1372 WP_000561983.1.13732 WP_000561983.1.13741 WP_000561983.1.13750 WP_000561983.1.13764 WP_000561983.1.13799 WP_000561983.1.13812 WP_000561983.1.13819 WP_000561983.1.1382 WP_000561983.1.13827 WP_000561983.1.13829 WP_000561983.1.13848 WP_000561983.1.13857 WP_000561983.1.1387 WP_000561983.1.13908 WP_000561983.1.13932 WP_000561983.1.13968 WP_000561983.1.1397 WP_000561983.1.13972 WP_000561983.1.13980 WP_000561983.1.140 WP_000561983.1.14001 WP_000561983.1.1401 WP_000561983.1.14011 WP_000561983.1.14041 WP_000561983.1.14050 WP_000561983.1.14056 WP_000561983.1.1408 WP_000561983.1.14089 WP_000561983.1.14099 WP_000561983.1.14111 WP_000561983.1.1412 WP_000561983.1.14120 WP_000561983.1.14123 WP_000561983.1.14150 WP_000561983.1.14151 WP_000561983.1.14191 WP_000561983.1.14197 WP_000561983.1.14212 WP_000561983.1.14239 WP_000561983.1.14280 WP_000561983.1.14286 WP_000561983.1.14296 WP_000561983.1.14320 WP_000561983.1.14333 WP_000561983.1.14369 WP_000561983.1.14379 WP_000561983.1.14399 WP_000561983.1.1440 WP_000561983.1.14406 WP_000561983.1.14410 WP_000561983.1.14436 WP_000561983.1.14444 WP_000561983.1.14446 WP_000561983.1.14458 WP_000561983.1.14466 WP_000561983.1.14467 WP_000561983.1.14474 WP_000561983.1.14495 WP_000561983.1.14500 WP_000561983.1.14505 WP_000561983.1.14516 WP_000561983.1.14519 WP_000561983.1.14524 WP_000561983.1.14526 WP_000561983.1.14528 WP_000561983.1.14550 WP_000561983.1.14554 WP_000561983.1.14575 WP_000561983.1.146 WP_000561983.1.14618 WP_000561983.1.14688 WP_000561983.1.14701 WP_000561983.1.14703 WP_000561983.1.14706 WP_000561983.1.14708 WP_000561983.1.14719 WP_000561983.1.14725 WP_000561983.1.1473 WP_000561983.1.14737 WP_000561983.1.14765 WP_000561983.1.14789 WP_000561983.1.14793 WP_000561983.1.14808 WP_000561983.1.14810 WP_000561983.1.14819 WP_000561983.1.14852 WP_000561983.1.14876 WP_000561983.1.14877 WP_000561983.1.14884 WP_000561983.1.1489 WP_000561983.1.14894 WP_000561983.1.14913 WP_000561983.1.14917 WP_000561983.1.14927 WP_000561983.1.14930 WP_000561983.1.14932 WP_000561983.1.14936 WP_000561983.1.14947 WP_000561983.1.14948 WP_000561983.1.14964 WP_000561983.1.15046 WP_000561983.1.15054 WP_000561983.1.15055 WP_000561983.1.15059 WP_000561983.1.15067 WP_000561983.1.15079 WP_000561983.1.15100 WP_000561983.1.15102 WP_000561983.1.15124 WP_000561983.1.15184 WP_000561983.1.15214 WP_000561983.1.15223 WP_000561983.1.15226 WP_000561983.1.15244 WP_000561983.1.15265 WP_000561983.1.15276 WP_000561983.1.15316 WP_000561983.1.15318 WP_000561983.1.15353 WP_000561983.1.15362 WP_000561983.1.15369 WP_000561983.1.1540 WP_000561983.1.15415 WP_000561983.1.15423 WP_000561983.1.15433 WP_000561983.1.15439 WP_000561983.1.15479 WP_000561983.1.15483 WP_000561983.1.15486 WP_000561983.1.15487 WP_000561983.1.15508 WP_000561983.1.1551 WP_000561983.1.15535 WP_000561983.1.15581 WP_000561983.1.15585 WP_000561983.1.15586 WP_000561983.1.15597 WP_000561983.1.15612 WP_000561983.1.15616 WP_000561983.1.15625 WP_000561983.1.15627 WP_000561983.1.15637 WP_000561983.1.15644 WP_000561983.1.15667 WP_000561983.1.1568 WP_000561983.1.15708 WP_000561983.1.15710 WP_000561983.1.15717 WP_000561983.1.15775 WP_000561983.1.15777 WP_000561983.1.15784 WP_000561983.1.15795 WP_000561983.1.158 WP_000561983.1.15830 WP_000561983.1.15835 WP_000561983.1.15862 WP_000561983.1.15881 WP_000561983.1.15905 WP_000561983.1.15909 WP_000561983.1.15910 WP_000561983.1.15912 WP_000561983.1.1592 WP_000561983.1.15922 WP_000561983.1.15944 WP_000561983.1.15970 WP_000561983.1.15978 WP_000561983.1.15986 WP_000561983.1.15995 WP_000561983.1.16000 WP_000561983.1.16004 WP_000561983.1.16006 WP_000561983.1.1601 WP_000561983.1.16028 WP_000561983.1.16032 WP_000561983.1.16046 WP_000561983.1.16047 WP_000561983.1.16051 WP_000561983.1.16052 WP_000561983.1.16058 WP_000561983.1.16062 WP_000561983.1.16063 WP_000561983.1.16103 WP_000561983.1.1611 WP_000561983.1.16125 WP_000561983.1.16150 WP_000561983.1.16155 WP_000561983.1.16158 WP_000561983.1.16166 WP_000561983.1.16172 WP_000561983.1.16201 WP_000561983.1.16226 WP_000561983.1.16233 WP_000561983.1.16244 WP_000561983.1.1626 WP_000561983.1.16264 WP_000561983.1.16273 WP_000561983.1.16284 WP_000561983.1.16328 WP_000561983.1.16331 WP_000561983.1.16344 WP_000561983.1.1635 WP_000561983.1.16361 WP_000561983.1.16363 WP_000561983.1.16365 WP_000561983.1.16366 WP_000561983.1.16394 WP_000561983.1.16452 WP_000561983.1.16453 WP_000561983.1.16461 WP_000561983.1.16462 WP_000561983.1.16465 WP_000561983.1.16468 WP_000561983.1.16474 WP_000561983.1.16508 WP_000561983.1.16522 WP_000561983.1.16525 WP_000561983.1.16551 WP_000561983.1.16563 WP_000561983.1.16565 WP_000561983.1.16581 WP_000561983.1.16588 WP_000561983.1.16614 WP_000561983.1.16650 WP_000561983.1.16656 WP_000561983.1.16658 WP_000561983.1.16666 WP_000561983.1.16673 WP_000561983.1.1668 WP_000561983.1.16686 WP_000561983.1.16691 WP_000561983.1.167 WP_000561983.1.16704 WP_000561983.1.16729 WP_000561983.1.16732 WP_000561983.1.16735 WP_000561983.1.16736 WP_000561983.1.1674 WP_000561983.1.16767 WP_000561983.1.16781 WP_000561983.1.16786 WP_000561983.1.16804 WP_000561983.1.16817 WP_000561983.1.16819 WP_000561983.1.16826 WP_000561983.1.16846 WP_000561983.1.16855 WP_000561983.1.16858 WP_000561983.1.16873 WP_000561983.1.16879 WP_000561983.1.1689 WP_000561983.1.16893 WP_000561983.1.16896 WP_000561983.1.16903 WP_000561983.1.16905 WP_000561983.1.16910 WP_000561983.1.16916 WP_000561983.1.16941 WP_000561983.1.16944 WP_000561983.1.16948 WP_000561983.1.16949 WP_000561983.1.16965 WP_000561983.1.16972 WP_000561983.1.16998 WP_000561983.1.1700 WP_000561983.1.17031 WP_000561983.1.17049 WP_000561983.1.17058 WP_000561983.1.17060 WP_000561983.1.17078 WP_000561983.1.17093 WP_000561983.1.17096 WP_000561983.1.17098 WP_000561983.1.17105 WP_000561983.1.17188 WP_000561983.1.17202 WP_000561983.1.17219 WP_000561983.1.1722 WP_000561983.1.17270 WP_000561983.1.17285 WP_000561983.1.17302 WP_000561983.1.17307 WP_000561983.1.17308 WP_000561983.1.1733 WP_000561983.1.17368 WP_000561983.1.1737 WP_000561983.1.17390 WP_000561983.1.174 WP_000561983.1.17405 WP_000561983.1.17406 WP_000561983.1.17439 WP_000561983.1.17447 WP_000561983.1.17480 WP_000561983.1.17482 WP_000561983.1.1749 WP_000561983.1.17504 WP_000561983.1.17513 WP_000561983.1.17525 WP_000561983.1.17543 WP_000561983.1.17546 WP_000561983.1.17560 WP_000561983.1.17563 WP_000561983.1.1757 WP_000561983.1.17578 WP_000561983.1.17583 WP_000561983.1.17622 WP_000561983.1.17629 WP_000561983.1.17659 WP_000561983.1.17667 WP_000561983.1.17686 WP_000561983.1.17693 WP_000561983.1.17702 WP_000561983.1.17705 WP_000561983.1.17732 WP_000561983.1.17741 WP_000561983.1.17743 WP_000561983.1.17755 WP_000561983.1.17840 WP_000561983.1.17865 WP_000561983.1.17886 WP_000561983.1.17891 WP_000561983.1.17901 WP_000561983.1.17914 WP_000561983.1.17919 WP_000561983.1.17936 WP_000561983.1.17949 WP_000561983.1.17956 WP_000561983.1.1798 WP_000561983.1.17991 WP_000561983.1.18005 WP_000561983.1.1801 WP_000561983.1.18019 WP_000561983.1.18021 WP_000561983.1.18022 WP_000561983.1.18056 WP_000561983.1.18061 WP_000561983.1.1807 WP_000561983.1.18089 WP_000561983.1.18092 WP_000561983.1.18099 WP_000561983.1.18103 WP_000561983.1.18109 WP_000561983.1.18111 WP_000561983.1.18122 WP_000561983.1.18124 WP_000561983.1.18144 WP_000561983.1.18149 WP_000561983.1.18163 WP_000561983.1.18173 WP_000561983.1.18177 WP_000561983.1.18178 WP_000561983.1.1818 WP_000561983.1.18192 WP_000561983.1.18249 WP_000561983.1.1825 WP_000561983.1.18254 WP_000561983.1.18265 WP_000561983.1.18267 WP_000561983.1.18270 WP_000561983.1.18277 WP_000561983.1.18280 WP_000561983.1.18281 WP_000561983.1.18282 WP_000561983.1.18328 WP_000561983.1.18358 WP_000561983.1.18365 WP_000561983.1.18370 WP_000561983.1.18384 WP_000561983.1.18406 WP_000561983.1.18426 WP_000561983.1.18441 WP_000561983.1.18445 WP_000561983.1.18468 WP_000561983.1.18474 WP_000561983.1.18483 WP_000561983.1.18485 WP_000561983.1.18489 WP_000561983.1.18513 WP_000561983.1.18607 WP_000561983.1.18610 WP_000561983.1.18641 WP_000561983.1.18678 WP_000561983.1.18686 WP_000561983.1.18688 WP_000561983.1.18692 WP_000561983.1.18705 WP_000561983.1.18715 WP_000561983.1.18722 WP_000561983.1.18737 WP_000561983.1.18766 WP_000561983.1.18776 WP_000561983.1.1880 WP_000561983.1.18822 WP_000561983.1.18847 WP_000561983.1.1885 WP_000561983.1.18860 WP_000561983.1.18881 WP_000561983.1.18886 WP_000561983.1.18895 WP_000561983.1.18919 WP_000561983.1.18922 WP_000561983.1.18940 WP_000561983.1.18949 WP_000561983.1.1895 WP_000561983.1.18959 WP_000561983.1.1897 WP_000561983.1.18972 WP_000561983.1.19001 WP_000561983.1.19006 WP_000561983.1.19030 WP_000561983.1.19038 WP_000561983.1.19044 WP_000561983.1.19053 WP_000561983.1.19055 WP_000561983.1.19064 WP_000561983.1.19084 WP_000561983.1.19093 WP_000561983.1.19163 WP_000561983.1.19174 WP_000561983.1.19187 WP_000561983.1.19228 WP_000561983.1.19240 WP_000561983.1.19273 WP_000561983.1.19288 WP_000561983.1.19291 WP_000561983.1.19300 WP_000561983.1.19320 WP_000561983.1.19340 WP_000561983.1.1935 WP_000561983.1.19357 WP_000561983.1.19373 WP_000561983.1.1939 WP_000561983.1.19405 WP_000561983.1.19422 WP_000561983.1.19433 WP_000561983.1.19454 WP_000561983.1.19456 WP_000561983.1.19458 WP_000561983.1.19460 WP_000561983.1.19461 WP_000561983.1.19469 WP_000561983.1.19496 WP_000561983.1.19535 WP_000561983.1.19538 WP_000561983.1.1954 WP_000561983.1.1955 WP_000561983.1.19588 WP_000561983.1.19589 WP_000561983.1.19614 WP_000561983.1.19616 WP_000561983.1.19642 WP_000561983.1.19656 WP_000561983.1.19660 WP_000561983.1.19663 WP_000561983.1.1968 WP_000561983.1.19683 WP_000561983.1.19686 WP_000561983.1.19702 WP_000561983.1.19706 WP_000561983.1.19723 WP_000561983.1.19724 WP_000561983.1.19731 WP_000561983.1.19740 WP_000561983.1.19749 WP_000561983.1.19784 WP_000561983.1.19793 WP_000561983.1.19794 WP_000561983.1.19802 WP_000561983.1.19809 WP_000561983.1.19823 WP_000561983.1.19834 WP_000561983.1.19851 WP_000561983.1.19863 WP_000561983.1.19867 WP_000561983.1.19884 WP_000561983.1.1990 WP_000561983.1.1992 WP_000561983.1.19938 WP_000561983.1.19967 WP_000561983.1.19970 WP_000561983.1.19975 WP_000561983.1.1998 WP_000561983.1.19987 WP_000561983.1.19999 WP_000561983.1.20 WP_000561983.1.20023 WP_000561983.1.20034 WP_000561983.1.20081 WP_000561983.1.20086 WP_000561983.1.20089 WP_000561983.1.20091 WP_000561983.1.2010 WP_000561983.1.20119 WP_000561983.1.20153 WP_000561983.1.20212 WP_000561983.1.20218 WP_000561983.1.20254 WP_000561983.1.20255 WP_000561983.1.2026 WP_000561983.1.20261 WP_000561983.1.20266 WP_000561983.1.20271 WP_000561983.1.20296 WP_000561983.1.20330 WP_000561983.1.20339 WP_000561983.1.20349 WP_000561983.1.2036 WP_000561983.1.20362 WP_000561983.1.20364 WP_000561983.1.20376 WP_000561983.1.20391 WP_000561983.1.2041 WP_000561983.1.20415 WP_000561983.1.20418 WP_000561983.1.20419 WP_000561983.1.20425 WP_000561983.1.20437 WP_000561983.1.20443 WP_000561983.1.20446 WP_000561983.1.20465 WP_000561983.1.2047 WP_000561983.1.20488 WP_000561983.1.20492 WP_000561983.1.20503 WP_000561983.1.20525 WP_000561983.1.2053 WP_000561983.1.2054 WP_000561983.1.20553 WP_000561983.1.20573 WP_000561983.1.20614 WP_000561983.1.20626 WP_000561983.1.20631 WP_000561983.1.20635 WP_000561983.1.20646 WP_000561983.1.20695 WP_000561983.1.20700 WP_000561983.1.20718 WP_000561983.1.20721 WP_000561983.1.2073 WP_000561983.1.20740 WP_000561983.1.20760 WP_000561983.1.20767 WP_000561983.1.20787 WP_000561983.1.20789 WP_000561983.1.20795 WP_000561983.1.20810 WP_000561983.1.20828 WP_000561983.1.20839 WP_000561983.1.20862 WP_000561983.1.2087 WP_000561983.1.20883 WP_000561983.1.20886 WP_000561983.1.20894 WP_000561983.1.20900 WP_000561983.1.20908 WP_000561983.1.2091 WP_000561983.1.20947 WP_000561983.1.20953 WP_000561983.1.2101 WP_000561983.1.21010 WP_000561983.1.21049 WP_000561983.1.2106 WP_000561983.1.21062 WP_000561983.1.2107 WP_000561983.1.21075 WP_000561983.1.21079 WP_000561983.1.21086 WP_000561983.1.21089 WP_000561983.1.21103 WP_000561983.1.21136 WP_000561983.1.21144 WP_000561983.1.21146 WP_000561983.1.2116 WP_000561983.1.21162 WP_000561983.1.21165 WP_000561983.1.21181 WP_000561983.1.21184 WP_000561983.1.21185 WP_000561983.1.21194 WP_000561983.1.21202 WP_000561983.1.21241 WP_000561983.1.21245 WP_000561983.1.21246 WP_000561983.1.21260 WP_000561983.1.21269 WP_000561983.1.21286 WP_000561983.1.2130 WP_000561983.1.21309 WP_000561983.1.21326 WP_000561983.1.21332 WP_000561983.1.21351 WP_000561983.1.21362 WP_000561983.1.21366 WP_000561983.1.21399 WP_000561983.1.21400 WP_000561983.1.21404 WP_000561983.1.21423 WP_000561983.1.21443 WP_000561983.1.21453 WP_000561983.1.2146 WP_000561983.1.21473 WP_000561983.1.21492 WP_000561983.1.21497 WP_000561983.1.21499 WP_000561983.1.21548 WP_000561983.1.21603 WP_000561983.1.21616 WP_000561983.1.2166 WP_000561983.1.21674 WP_000561983.1.21681 WP_000561983.1.21692 WP_000561983.1.21715 WP_000561983.1.21728 WP_000561983.1.21730 WP_000561983.1.21750 WP_000561983.1.21751 WP_000561983.1.21757 WP_000561983.1.21792 WP_000561983.1.21825 WP_000561983.1.21845 WP_000561983.1.21877 WP_000561983.1.21886 WP_000561983.1.21909 WP_000561983.1.21910 WP_000561983.1.21940 WP_000561983.1.21946 WP_000561983.1.21950 WP_000561983.1.21966 WP_000561983.1.21981 WP_000561983.1.21991 WP_000561983.1.22019 WP_000561983.1.22024 WP_000561983.1.22030 WP_000561983.1.2205 WP_000561983.1.22051 WP_000561983.1.22062 WP_000561983.1.22064 WP_000561983.1.22067 WP_000561983.1.22069 WP_000561983.1.22096 WP_000561983.1.22117 WP_000561983.1.22118 WP_000561983.1.22126 WP_000561983.1.22136 WP_000561983.1.22158 WP_000561983.1.2216 WP_000561983.1.22162 WP_000561983.1.22169 WP_000561983.1.22205 WP_000561983.1.22208 WP_000561983.1.2221 WP_000561983.1.22235 WP_000561983.1.2224 WP_000561983.1.22240 WP_000561983.1.2227 WP_000561983.1.22296 WP_000561983.1.22303 WP_000561983.1.22315 WP_000561983.1.22323 WP_000561983.1.22337 WP_000561983.1.22346 WP_000561983.1.2235 WP_000561983.1.22373 WP_000561983.1.22379 WP_000561983.1.22388 WP_000561983.1.22427 WP_000561983.1.22449 WP_000561983.1.22453 WP_000561983.1.22454 WP_000561983.1.2246 WP_000561983.1.22460 WP_000561983.1.22476 WP_000561983.1.22485 WP_000561983.1.22514 WP_000561983.1.22537 WP_000561983.1.22565 WP_000561983.1.22575 WP_000561983.1.22582 WP_000561983.1.22590 WP_000561983.1.22595 WP_000561983.1.22604 WP_000561983.1.22605 WP_000561983.1.22614 WP_000561983.1.22620 WP_000561983.1.22623 WP_000561983.1.22645 WP_000561983.1.22652 WP_000561983.1.22676 WP_000561983.1.22683 WP_000561983.1.22692 WP_000561983.1.22758 WP_000561983.1.22760 WP_000561983.1.2283 WP_000561983.1.2284 WP_000561983.1.22845 WP_000561983.1.22855 WP_000561983.1.22857 WP_000561983.1.22864 WP_000561983.1.22870 WP_000561983.1.22880 WP_000561983.1.22895 WP_000561983.1.22902 WP_000561983.1.22926 WP_000561983.1.22943 WP_000561983.1.22947 WP_000561983.1.22966 WP_000561983.1.22967 WP_000561983.1.22979 WP_000561983.1.23010 WP_000561983.1.23040 WP_000561983.1.23041 WP_000561983.1.23053 WP_000561983.1.23058 WP_000561983.1.23080 WP_000561983.1.23102 WP_000561983.1.23114 WP_000561983.1.2314 WP_000561983.1.23148 WP_000561983.1.23155 WP_000561983.1.23169 WP_000561983.1.23172 WP_000561983.1.23175 WP_000561983.1.23192 WP_000561983.1.23201 WP_000561983.1.23218 WP_000561983.1.23219 WP_000561983.1.2324 WP_000561983.1.23246 WP_000561983.1.23258 WP_000561983.1.23259 WP_000561983.1.23274 WP_000561983.1.23279 WP_000561983.1.23309 WP_000561983.1.2331 WP_000561983.1.23311 WP_000561983.1.2332 WP_000561983.1.23329 WP_000561983.1.23340 WP_000561983.1.23341 WP_000561983.1.23343 WP_000561983.1.2336 WP_000561983.1.23365 WP_000561983.1.23379 WP_000561983.1.23409 WP_000561983.1.23412 WP_000561983.1.2342 WP_000561983.1.23426 WP_000561983.1.2343 WP_000561983.1.23442 WP_000561983.1.23444 WP_000561983.1.23460 WP_000561983.1.23466 WP_000561983.1.23472 WP_000561983.1.23482 WP_000561983.1.23485 WP_000561983.1.23492 WP_000561983.1.235 WP_000561983.1.23500 WP_000561983.1.23503 WP_000561983.1.23509 WP_000561983.1.23513 WP_000561983.1.23515 WP_000561983.1.23529 WP_000561983.1.23548 WP_000561983.1.23571 WP_000561983.1.2358 WP_000561983.1.23587 WP_000561983.1.23604 WP_000561983.1.23621 WP_000561983.1.23629 WP_000561983.1.23631 WP_000561983.1.23634 WP_000561983.1.23639 WP_000561983.1.2364 WP_000561983.1.23643 WP_000561983.1.23646 WP_000561983.1.23670 WP_000561983.1.23675 WP_000561983.1.23679 WP_000561983.1.23685 WP_000561983.1.237 WP_000561983.1.23707 WP_000561983.1.23720 WP_000561983.1.23728 WP_000561983.1.23736 WP_000561983.1.23746 WP_000561983.1.2375 WP_000561983.1.23755 WP_000561983.1.2376 WP_000561983.1.23783 WP_000561983.1.23786 WP_000561983.1.23787 WP_000561983.1.2380 WP_000561983.1.23801 WP_000561983.1.23819 WP_000561983.1.23932 WP_000561983.1.23959 WP_000561983.1.24017 WP_000561983.1.24028 WP_000561983.1.24061 WP_000561983.1.24069 WP_000561983.1.24082 WP_000561983.1.24083 WP_000561983.1.24117 WP_000561983.1.24125 WP_000561983.1.24138 WP_000561983.1.24145 WP_000561983.1.2415 WP_000561983.1.24153 WP_000561983.1.24158 WP_000561983.1.24163 WP_000561983.1.24206 WP_000561983.1.24214 WP_000561983.1.24250 WP_000561983.1.24259 WP_000561983.1.24291 WP_000561983.1.24297 WP_000561983.1.24303 WP_000561983.1.24308 WP_000561983.1.24322 WP_000561983.1.24325 WP_000561983.1.24355 WP_000561983.1.24361 WP_000561983.1.24375 WP_000561983.1.24376 WP_000561983.1.24392 WP_000561983.1.24400 WP_000561983.1.24408 WP_000561983.1.24409 WP_000561983.1.24412 WP_000561983.1.24419 WP_000561983.1.24420 WP_000561983.1.24433 WP_000561983.1.24444 WP_000561983.1.24450 WP_000561983.1.24476 WP_000561983.1.24494 WP_000561983.1.24521 WP_000561983.1.24555 WP_000561983.1.24567 WP_000561983.1.24578 WP_000561983.1.24619 WP_000561983.1.24643 WP_000561983.1.2467 WP_000561983.1.24673 WP_000561983.1.24686 WP_000561983.1.24688 WP_000561983.1.24689 WP_000561983.1.24696 WP_000561983.1.24716 WP_000561983.1.24723 WP_000561983.1.24727 WP_000561983.1.24737 WP_000561983.1.24779 WP_000561983.1.24803 WP_000561983.1.2481 WP_000561983.1.24832 WP_000561983.1.24837 WP_000561983.1.24839 WP_000561983.1.24873 WP_000561983.1.24901 WP_000561983.1.24944 WP_000561983.1.24964 WP_000561983.1.24995 WP_000561983.1.25008 WP_000561983.1.25015 WP_000561983.1.25017 WP_000561983.1.25032 WP_000561983.1.25036 WP_000561983.1.25041 WP_000561983.1.25053 WP_000561983.1.25064 WP_000561983.1.25072 WP_000561983.1.25119 WP_000561983.1.25130 WP_000561983.1.25140 WP_000561983.1.25159 WP_000561983.1.25175 WP_000561983.1.25185 WP_000561983.1.25196 WP_000561983.1.25205 WP_000561983.1.25206 WP_000561983.1.25210 WP_000561983.1.25217 WP_000561983.1.25219 WP_000561983.1.25229 WP_000561983.1.2525 WP_000561983.1.25297 WP_000561983.1.25304 WP_000561983.1.25354 WP_000561983.1.25374 WP_000561983.1.25397 WP_000561983.1.25405 WP_000561983.1.25421 WP_000561983.1.25426 WP_000561983.1.25454 WP_000561983.1.25475 WP_000561983.1.25490 WP_000561983.1.25493 WP_000561983.1.25498 WP_000561983.1.25508 WP_000561983.1.25512 WP_000561983.1.25514 WP_000561983.1.2554 WP_000561983.1.25546 WP_000561983.1.25564 WP_000561983.1.25596 WP_000561983.1.25603 WP_000561983.1.25607 WP_000561983.1.25618 WP_000561983.1.2562 WP_000561983.1.25666 WP_000561983.1.25668 WP_000561983.1.2568 WP_000561983.1.25690 WP_000561983.1.25692 WP_000561983.1.2570 WP_000561983.1.25700 WP_000561983.1.25703 WP_000561983.1.25708 WP_000561983.1.25709 WP_000561983.1.25722 WP_000561983.1.25740 WP_000561983.1.25780 WP_000561983.1.25793 WP_000561983.1.25807 WP_000561983.1.25809 WP_000561983.1.2581 WP_000561983.1.25814 WP_000561983.1.25821 WP_000561983.1.25825 WP_000561983.1.25833 WP_000561983.1.25835 WP_000561983.1.25882 WP_000561983.1.25911 WP_000561983.1.25928 WP_000561983.1.25932 WP_000561983.1.25944 WP_000561983.1.25951 WP_000561983.1.25962 WP_000561983.1.25963 WP_000561983.1.25988 WP_000561983.1.26001 WP_000561983.1.26027 WP_000561983.1.26030 WP_000561983.1.26034 WP_000561983.1.26075 WP_000561983.1.26083 WP_000561983.1.26093 WP_000561983.1.26107 WP_000561983.1.26123 WP_000561983.1.26129 WP_000561983.1.2615 WP_000561983.1.26194 WP_000561983.1.26199 WP_000561983.1.26213 WP_000561983.1.26217 WP_000561983.1.26224 WP_000561983.1.26230 WP_000561983.1.26232 WP_000561983.1.26269 WP_000561983.1.26272 WP_000561983.1.26282 WP_000561983.1.26286 WP_000561983.1.26288 WP_000561983.1.26311 WP_000561983.1.26319 WP_000561983.1.2634 WP_000561983.1.26363 WP_000561983.1.26384 WP_000561983.1.26394 WP_000561983.1.26426 WP_000561983.1.26429 WP_000561983.1.26440 WP_000561983.1.26441 WP_000561983.1.26491 WP_000561983.1.26493 WP_000561983.1.26512 WP_000561983.1.26532 WP_000561983.1.2654 WP_000561983.1.26551 WP_000561983.1.26554 WP_000561983.1.26563 WP_000561983.1.26567 WP_000561983.1.26576 WP_000561983.1.26582 WP_000561983.1.26587 WP_000561983.1.2660 WP_000561983.1.26636 WP_000561983.1.26646 WP_000561983.1.2667 WP_000561983.1.26687 WP_000561983.1.26689 WP_000561983.1.26709 WP_000561983.1.2672 WP_000561983.1.26741 WP_000561983.1.26758 WP_000561983.1.26787 WP_000561983.1.2679 WP_000561983.1.26794 WP_000561983.1.26833 WP_000561983.1.26856 WP_000561983.1.26882 WP_000561983.1.26883 WP_000561983.1.26892 WP_000561983.1.26908 WP_000561983.1.26919 WP_000561983.1.2692 WP_000561983.1.26924 WP_000561983.1.26928 WP_000561983.1.26936 WP_000561983.1.26980 WP_000561983.1.270 WP_000561983.1.27008 WP_000561983.1.27010 WP_000561983.1.27027 WP_000561983.1.27051 WP_000561983.1.27055 WP_000561983.1.27070 WP_000561983.1.27072 WP_000561983.1.27077 WP_000561983.1.27084 WP_000561983.1.27086 WP_000561983.1.27087 WP_000561983.1.27111 WP_000561983.1.27115 WP_000561983.1.27122 WP_000561983.1.2713 WP_000561983.1.27142 WP_000561983.1.27169 WP_000561983.1.2717 WP_000561983.1.27173 WP_000561983.1.272 WP_000561983.1.27206 WP_000561983.1.27223 WP_000561983.1.27228 WP_000561983.1.2723 WP_000561983.1.27255 WP_000561983.1.27272 WP_000561983.1.27279 WP_000561983.1.27282 WP_000561983.1.27285 WP_000561983.1.27309 WP_000561983.1.27314 WP_000561983.1.27329 WP_000561983.1.27342 WP_000561983.1.27361 WP_000561983.1.27383 WP_000561983.1.27419 WP_000561983.1.27423 WP_000561983.1.27452 WP_000561983.1.27513 WP_000561983.1.27522 WP_000561983.1.27523 WP_000561983.1.27535 WP_000561983.1.27544 WP_000561983.1.27547 WP_000561983.1.27556 WP_000561983.1.27561 WP_000561983.1.27565 WP_000561983.1.27595 WP_000561983.1.27598 WP_000561983.1.27616 WP_000561983.1.2763 WP_000561983.1.27632 WP_000561983.1.27638 WP_000561983.1.27655 WP_000561983.1.27658 WP_000561983.1.27665 WP_000561983.1.27679 WP_000561983.1.27706 WP_000561983.1.27707 WP_000561983.1.27713 WP_000561983.1.27755 WP_000561983.1.27761 WP_000561983.1.2777 WP_000561983.1.27775 WP_000561983.1.27776 WP_000561983.1.27785 WP_000561983.1.27798 WP_000561983.1.27800 WP_000561983.1.27815 WP_000561983.1.27833 WP_000561983.1.27857 WP_000561983.1.27883 WP_000561983.1.27892 WP_000561983.1.27900 WP_000561983.1.27928 WP_000561983.1.27945 WP_000561983.1.27969 WP_000561983.1.27977 WP_000561983.1.27995 WP_000561983.1.27997 WP_000561983.1.28002 WP_000561983.1.28004 WP_000561983.1.28032 WP_000561983.1.28037 WP_000561983.1.28056 WP_000561983.1.2806 WP_000561983.1.28073 WP_000561983.1.2809 WP_000561983.1.28094 WP_000561983.1.28116 WP_000561983.1.28126 WP_000561983.1.28139 WP_000561983.1.28155 WP_000561983.1.28170 WP_000561983.1.28174 WP_000561983.1.28198 WP_000561983.1.28200 WP_000561983.1.2822 WP_000561983.1.28225 WP_000561983.1.28229 WP_000561983.1.28232 WP_000561983.1.28233 WP_000561983.1.28235 WP_000561983.1.2825 WP_000561983.1.28267 WP_000561983.1.2829 WP_000561983.1.28301 WP_000561983.1.28302 WP_000561983.1.28303 WP_000561983.1.2835 WP_000561983.1.28370 WP_000561983.1.28384 WP_000561983.1.28386 WP_000561983.1.28393 WP_000561983.1.28395 WP_000561983.1.284 WP_000561983.1.2845 WP_000561983.1.28462 WP_000561983.1.28479 WP_000561983.1.28504 WP_000561983.1.28512 WP_000561983.1.28514 WP_000561983.1.2853 WP_000561983.1.28538 WP_000561983.1.28570 WP_000561983.1.28575 WP_000561983.1.28612 WP_000561983.1.28620 WP_000561983.1.28625 WP_000561983.1.28627 WP_000561983.1.28655 WP_000561983.1.28665 WP_000561983.1.28673 WP_000561983.1.28692 WP_000561983.1.28694 WP_000561983.1.287 WP_000561983.1.2873 WP_000561983.1.28733 WP_000561983.1.28773 WP_000561983.1.28775 WP_000561983.1.28776 WP_000561983.1.2879 WP_000561983.1.28811 WP_000561983.1.28830 WP_000561983.1.2890 WP_000561983.1.28902 WP_000561983.1.28917 WP_000561983.1.28921 WP_000561983.1.28938 WP_000561983.1.28946 WP_000561983.1.28948 WP_000561983.1.28962 WP_000561983.1.28963 WP_000561983.1.28977 WP_000561983.1.29006 WP_000561983.1.29010 WP_000561983.1.29023 WP_000561983.1.29042 WP_000561983.1.2905 WP_000561983.1.2907 WP_000561983.1.29081 WP_000561983.1.29089 WP_000561983.1.29099 WP_000561983.1.2910 WP_000561983.1.29113 WP_000561983.1.29130 WP_000561983.1.29153 WP_000561983.1.29168 WP_000561983.1.29174 WP_000561983.1.29190 WP_000561983.1.29203 WP_000561983.1.29218 WP_000561983.1.29237 WP_000561983.1.2924 WP_000561983.1.29248 WP_000561983.1.29255 WP_000561983.1.29265 WP_000561983.1.29274 WP_000561983.1.29288 WP_000561983.1.2932 WP_000561983.1.29349 WP_000561983.1.29379 WP_000561983.1.29389 WP_000561983.1.29422 WP_000561983.1.29436 WP_000561983.1.29439 WP_000561983.1.29454 WP_000561983.1.2946 WP_000561983.1.29462 WP_000561983.1.29509 WP_000561983.1.29530 WP_000561983.1.29563 WP_000561983.1.29576 WP_000561983.1.29588 WP_000561983.1.29593 WP_000561983.1.29601 WP_000561983.1.29606 WP_000561983.1.29615 WP_000561983.1.29619 WP_000561983.1.29682 WP_000561983.1.29704 WP_000561983.1.29711 WP_000561983.1.29727 WP_000561983.1.29732 WP_000561983.1.29743 WP_000561983.1.29768 WP_000561983.1.29774 WP_000561983.1.29775 WP_000561983.1.29782 WP_000561983.1.29827 WP_000561983.1.29833 WP_000561983.1.2984 WP_000561983.1.29845 WP_000561983.1.29851 WP_000561983.1.29865 WP_000561983.1.29886 WP_000561983.1.29898 WP_000561983.1.29919 WP_000561983.1.29923 WP_000561983.1.29924 WP_000561983.1.2994 WP_000561983.1.29964 WP_000561983.1.29969 WP_000561983.1.29983 WP_000561983.1.29990 WP_000561983.1.30006 WP_000561983.1.30009 WP_000561983.1.30013 WP_000561983.1.3002 WP_000561983.1.30022 WP_000561983.1.30027 WP_000561983.1.30034 WP_000561983.1.30049 WP_000561983.1.3005 WP_000561983.1.30058 WP_000561983.1.30059 WP_000561983.1.30086 WP_000561983.1.30093 WP_000561983.1.30165 WP_000561983.1.3017 WP_000561983.1.30170 WP_000561983.1.30172 WP_000561983.1.30179 WP_000561983.1.30180 WP_000561983.1.30185 WP_000561983.1.30195 WP_000561983.1.30202 WP_000561983.1.30210 WP_000561983.1.30213 WP_000561983.1.30225 WP_000561983.1.30238 WP_000561983.1.30246 WP_000561983.1.30278 WP_000561983.1.30331 WP_000561983.1.30354 WP_000561983.1.30356 WP_000561983.1.30357 WP_000561983.1.30362 WP_000561983.1.30386 WP_000561983.1.30389 WP_000561983.1.3042 WP_000561983.1.30421 WP_000561983.1.30425 WP_000561983.1.30437 WP_000561983.1.30440 WP_000561983.1.30448 WP_000561983.1.30469 WP_000561983.1.30489 WP_000561983.1.30492 WP_000561983.1.30505 WP_000561983.1.30507 WP_000561983.1.30517 WP_000561983.1.30535 WP_000561983.1.30542 WP_000561983.1.30544 WP_000561983.1.30547 WP_000561983.1.30548 WP_000561983.1.30556 WP_000561983.1.30572 WP_000561983.1.30573 WP_000561983.1.30585 WP_000561983.1.30589 WP_000561983.1.30602 WP_000561983.1.30618 WP_000561983.1.30619 WP_000561983.1.30627 WP_000561983.1.30635 WP_000561983.1.3066 WP_000561983.1.30664 WP_000561983.1.3067 WP_000561983.1.3068 WP_000561983.1.30688 WP_000561983.1.30696 WP_000561983.1.30752 WP_000561983.1.3076 WP_000561983.1.30794 WP_000561983.1.3080 WP_000561983.1.30802 WP_000561983.1.30803 WP_000561983.1.30806 WP_000561983.1.30819 WP_000561983.1.30823 WP_000561983.1.30833 WP_000561983.1.30835 WP_000561983.1.3089 WP_000561983.1.30909 WP_000561983.1.30934 WP_000561983.1.3095 WP_000561983.1.30951 WP_000561983.1.30967 WP_000561983.1.30968 WP_000561983.1.30972 WP_000561983.1.31 WP_000561983.1.31001 WP_000561983.1.31011 WP_000561983.1.31042 WP_000561983.1.31046 WP_000561983.1.31066 WP_000561983.1.31078 WP_000561983.1.31086 WP_000561983.1.31092 WP_000561983.1.31107 WP_000561983.1.31111 WP_000561983.1.31122 WP_000561983.1.3113 WP_000561983.1.31139 WP_000561983.1.3114 WP_000561983.1.31145 WP_000561983.1.31155 WP_000561983.1.31156 WP_000561983.1.31167 WP_000561983.1.31171 WP_000561983.1.31182 WP_000561983.1.31185 WP_000561983.1.3119 WP_000561983.1.31190 WP_000561983.1.31195 WP_000561983.1.31196 WP_000561983.1.31198 WP_000561983.1.31205 WP_000561983.1.3121 WP_000561983.1.31210 WP_000561983.1.31214 WP_000561983.1.31219 WP_000561983.1.31222 WP_000561983.1.31223 WP_000561983.1.3124 WP_000561983.1.31240 WP_000561983.1.31251 WP_000561983.1.31262 WP_000561983.1.3127 WP_000561983.1.31272 WP_000561983.1.31281 WP_000561983.1.31303 WP_000561983.1.3131 WP_000561983.1.31335 WP_000561983.1.31352 WP_000561983.1.31362 WP_000561983.1.31389 WP_000561983.1.31413 WP_000561983.1.31435 WP_000561983.1.31446 WP_000561983.1.31451 WP_000561983.1.31476 WP_000561983.1.31504 WP_000561983.1.31515 WP_000561983.1.31533 WP_000561983.1.31578 WP_000561983.1.31585 WP_000561983.1.31590 WP_000561983.1.31658 WP_000561983.1.31665 WP_000561983.1.3167 WP_000561983.1.3170 WP_000561983.1.31725 WP_000561983.1.31762 WP_000561983.1.31782 WP_000561983.1.31799 WP_000561983.1.31836 WP_000561983.1.31845 WP_000561983.1.3185 WP_000561983.1.31854 WP_000561983.1.31895 WP_000561983.1.31901 WP_000561983.1.31927 WP_000561983.1.31940 WP_000561983.1.31951 WP_000561983.1.31952 WP_000561983.1.31967 WP_000561983.1.31972 WP_000561983.1.31983 WP_000561983.1.32006 WP_000561983.1.32038 WP_000561983.1.32041 WP_000561983.1.32042 WP_000561983.1.32054 WP_000561983.1.32056 WP_000561983.1.3207 WP_000561983.1.32109 WP_000561983.1.32116 WP_000561983.1.32170 WP_000561983.1.32189 WP_000561983.1.32192 WP_000561983.1.32202 WP_000561983.1.32204 WP_000561983.1.32206 WP_000561983.1.32252 WP_000561983.1.32255 WP_000561983.1.32260 WP_000561983.1.32263 WP_000561983.1.32274 WP_000561983.1.32275 WP_000561983.1.32277 WP_000561983.1.32293 WP_000561983.1.32299 WP_000561983.1.32309 WP_000561983.1.32357 WP_000561983.1.32368 WP_000561983.1.32408 WP_000561983.1.32422 WP_000561983.1.32423 WP_000561983.1.32424 WP_000561983.1.32425 WP_000561983.1.32434 WP_000561983.1.32438 WP_000561983.1.32458 WP_000561983.1.32459 WP_000561983.1.32460 WP_000561983.1.32491 WP_000561983.1.32515 WP_000561983.1.32519 WP_000561983.1.32527 WP_000561983.1.32529 WP_000561983.1.32545 WP_000561983.1.32563 WP_000561983.1.32578 WP_000561983.1.32617 WP_000561983.1.32624 WP_000561983.1.32629 WP_000561983.1.32643 WP_000561983.1.32660 WP_000561983.1.32668 WP_000561983.1.3270 WP_000561983.1.32702 WP_000561983.1.32714 WP_000561983.1.32725 WP_000561983.1.32740 WP_000561983.1.32747 WP_000561983.1.32750 WP_000561983.1.3278 WP_000561983.1.32786 WP_000561983.1.32804 WP_000561983.1.32832 WP_000561983.1.32838 WP_000561983.1.32848 WP_000561983.1.32860 WP_000561983.1.32868 WP_000561983.1.32881 WP_000561983.1.32899 WP_000561983.1.3290 WP_000561983.1.32900 WP_000561983.1.32902 WP_000561983.1.32907 WP_000561983.1.32930 WP_000561983.1.32940 WP_000561983.1.32941 WP_000561983.1.3296 WP_000561983.1.32961 WP_000561983.1.32966 WP_000561983.1.32977 WP_000561983.1.32985 WP_000561983.1.33010 WP_000561983.1.33030 WP_000561983.1.33037 WP_000561983.1.3304 WP_000561983.1.3305 WP_000561983.1.33050 WP_000561983.1.33051 WP_000561983.1.33065 WP_000561983.1.33068 WP_000561983.1.33078 WP_000561983.1.3310 WP_000561983.1.33106 WP_000561983.1.33114 WP_000561983.1.33122 WP_000561983.1.33127 WP_000561983.1.33134 WP_000561983.1.33143 WP_000561983.1.33144 WP_000561983.1.3315 WP_000561983.1.33160 WP_000561983.1.33208 WP_000561983.1.33214 WP_000561983.1.33247 WP_000561983.1.33248 WP_000561983.1.33253 WP_000561983.1.33261 WP_000561983.1.33270 WP_000561983.1.33280 WP_000561983.1.33283 WP_000561983.1.333 WP_000561983.1.33313 WP_000561983.1.33339 WP_000561983.1.33343 WP_000561983.1.33382 WP_000561983.1.33392 WP_000561983.1.33409 WP_000561983.1.33486 WP_000561983.1.33490 WP_000561983.1.33492 WP_000561983.1.33499 WP_000561983.1.335 WP_000561983.1.33501 WP_000561983.1.33529 WP_000561983.1.33553 WP_000561983.1.3356 WP_000561983.1.33580 WP_000561983.1.33586 WP_000561983.1.33592 WP_000561983.1.33609 WP_000561983.1.33629 WP_000561983.1.3364 WP_000561983.1.33659 WP_000561983.1.33689 WP_000561983.1.33693 WP_000561983.1.3370 WP_000561983.1.33730 WP_000561983.1.33741 WP_000561983.1.33786 WP_000561983.1.33817 WP_000561983.1.33825 WP_000561983.1.33840 WP_000561983.1.33865 WP_000561983.1.33870 WP_000561983.1.33894 WP_000561983.1.3392 WP_000561983.1.33926 WP_000561983.1.3394 WP_000561983.1.3395 WP_000561983.1.33957 WP_000561983.1.3396 WP_000561983.1.33969 WP_000561983.1.33986 WP_000561983.1.34 WP_000561983.1.34001 WP_000561983.1.34022 WP_000561983.1.34043 WP_000561983.1.34059 WP_000561983.1.34075 WP_000561983.1.34081 WP_000561983.1.34084 WP_000561983.1.34091 WP_000561983.1.34107 WP_000561983.1.34118 WP_000561983.1.34126 WP_000561983.1.34179 WP_000561983.1.34184 WP_000561983.1.34185 WP_000561983.1.34211 WP_000561983.1.34214 WP_000561983.1.34234 WP_000561983.1.34257 WP_000561983.1.34259 WP_000561983.1.34279 WP_000561983.1.34284 WP_000561983.1.34292 WP_000561983.1.34304 WP_000561983.1.34319 WP_000561983.1.34330 WP_000561983.1.34364 WP_000561983.1.34376 WP_000561983.1.3438 WP_000561983.1.34382 WP_000561983.1.34417 WP_000561983.1.34431 WP_000561983.1.3445 WP_000561983.1.34453 WP_000561983.1.34454 WP_000561983.1.34458 WP_000561983.1.34484 WP_000561983.1.34496 WP_000561983.1.345 WP_000561983.1.34517 WP_000561983.1.34530 WP_000561983.1.34539 WP_000561983.1.34610 WP_000561983.1.34614 WP_000561983.1.34647 WP_000561983.1.34659 WP_000561983.1.34665 WP_000561983.1.34667 WP_000561983.1.34684 WP_000561983.1.34694 WP_000561983.1.34703 WP_000561983.1.34704 WP_000561983.1.34707 WP_000561983.1.34711 WP_000561983.1.34745 WP_000561983.1.34751 WP_000561983.1.3476 WP_000561983.1.34801 WP_000561983.1.34808 WP_000561983.1.34817 WP_000561983.1.34820 WP_000561983.1.34824 WP_000561983.1.34834 WP_000561983.1.34854 WP_000561983.1.34856 WP_000561983.1.34881 WP_000561983.1.3489 WP_000561983.1.34907 WP_000561983.1.34932 WP_000561983.1.34962 WP_000561983.1.34972 WP_000561983.1.34975 WP_000561983.1.34977 WP_000561983.1.35001 WP_000561983.1.35035 WP_000561983.1.35040 WP_000561983.1.35045 WP_000561983.1.35074 WP_000561983.1.35075 WP_000561983.1.35125 WP_000561983.1.35129 WP_000561983.1.35175 WP_000561983.1.35184 WP_000561983.1.35193 WP_000561983.1.35219 WP_000561983.1.35240 WP_000561983.1.35274 WP_000561983.1.35294 WP_000561983.1.35298 WP_000561983.1.35321 WP_000561983.1.35332 WP_000561983.1.35371 WP_000561983.1.35404 WP_000561983.1.35408 WP_000561983.1.3541 WP_000561983.1.35425 WP_000561983.1.35429 WP_000561983.1.35446 WP_000561983.1.35460 WP_000561983.1.35463 WP_000561983.1.35494 WP_000561983.1.35503 WP_000561983.1.35509 WP_000561983.1.35532 WP_000561983.1.3556 WP_000561983.1.35560 WP_000561983.1.35563 WP_000561983.1.3557 WP_000561983.1.35570 WP_000561983.1.35575 WP_000561983.1.35590 WP_000561983.1.35594 WP_000561983.1.35619 WP_000561983.1.35624 WP_000561983.1.35628 WP_000561983.1.35648 WP_000561983.1.3566 WP_000561983.1.3570 WP_000561983.1.35712 WP_000561983.1.35713 WP_000561983.1.3572 WP_000561983.1.35736 WP_000561983.1.35777 WP_000561983.1.35791 WP_000561983.1.35795 WP_000561983.1.35809 WP_000561983.1.35835 WP_000561983.1.35847 WP_000561983.1.35868 WP_000561983.1.35870 WP_000561983.1.35887 WP_000561983.1.35892 WP_000561983.1.35916 WP_000561983.1.35936 WP_000561983.1.35938 WP_000561983.1.35940 WP_000561983.1.35961 WP_000561983.1.35966 WP_000561983.1.35993 WP_000561983.1.36000 WP_000561983.1.36003 WP_000561983.1.3601 WP_000561983.1.36011 WP_000561983.1.36017 WP_000561983.1.36034 WP_000561983.1.36036 WP_000561983.1.36037 WP_000561983.1.36063 WP_000561983.1.36069 WP_000561983.1.3610 WP_000561983.1.36157 WP_000561983.1.36172 WP_000561983.1.36229 WP_000561983.1.36232 WP_000561983.1.36236 WP_000561983.1.36286 WP_000561983.1.36291 WP_000561983.1.36298 WP_000561983.1.36308 WP_000561983.1.36323 WP_000561983.1.36343 WP_000561983.1.36409 WP_000561983.1.36425 WP_000561983.1.36445 WP_000561983.1.36460 WP_000561983.1.3649 WP_000561983.1.36495 WP_000561983.1.36512 WP_000561983.1.36526 WP_000561983.1.36542 WP_000561983.1.36547 WP_000561983.1.36564 WP_000561983.1.36567 WP_000561983.1.36579 WP_000561983.1.36584 WP_000561983.1.36592 WP_000561983.1.36609 WP_000561983.1.36617 WP_000561983.1.36618 WP_000561983.1.36643 WP_000561983.1.36652 WP_000561983.1.36663 WP_000561983.1.36685 WP_000561983.1.36690 WP_000561983.1.3670 WP_000561983.1.36701 WP_000561983.1.36705 WP_000561983.1.36721 WP_000561983.1.36725 WP_000561983.1.36751 WP_000561983.1.36764 WP_000561983.1.36765 WP_000561983.1.36779 WP_000561983.1.36792 WP_000561983.1.36798 WP_000561983.1.36802 WP_000561983.1.36821 WP_000561983.1.36839 WP_000561983.1.36853 WP_000561983.1.3688 WP_000561983.1.36885 WP_000561983.1.36889 WP_000561983.1.36899 WP_000561983.1.36918 WP_000561983.1.36931 WP_000561983.1.36949 WP_000561983.1.36950 WP_000561983.1.36978 WP_000561983.1.37013 WP_000561983.1.37014 WP_000561983.1.37021 WP_000561983.1.37028 WP_000561983.1.37029 WP_000561983.1.37063 WP_000561983.1.37073 WP_000561983.1.37100 WP_000561983.1.37111 WP_000561983.1.37112 WP_000561983.1.37114 WP_000561983.1.37119 WP_000561983.1.37133 WP_000561983.1.37147 WP_000561983.1.37158 WP_000561983.1.37176 WP_000561983.1.37190 WP_000561983.1.37191 WP_000561983.1.37199 WP_000561983.1.37200 WP_000561983.1.37256 WP_000561983.1.37258 WP_000561983.1.3726 WP_000561983.1.37267 WP_000561983.1.3728 WP_000561983.1.37293 WP_000561983.1.37297 WP_000561983.1.37303 WP_000561983.1.37320 WP_000561983.1.3734 WP_000561983.1.37351 WP_000561983.1.37363 WP_000561983.1.37376 WP_000561983.1.37405 WP_000561983.1.3741 WP_000561983.1.3744 WP_000561983.1.37478 WP_000561983.1.3748 WP_000561983.1.37498 WP_000561983.1.37504 WP_000561983.1.3751 WP_000561983.1.37513 WP_000561983.1.37521 WP_000561983.1.37558 WP_000561983.1.3756 WP_000561983.1.37584 WP_000561983.1.37590 WP_000561983.1.37593 WP_000561983.1.37600 WP_000561983.1.37610 WP_000561983.1.37613 WP_000561983.1.37618 WP_000561983.1.37659 WP_000561983.1.37662 WP_000561983.1.37666 WP_000561983.1.37675 WP_000561983.1.37687 WP_000561983.1.37691 WP_000561983.1.3771 WP_000561983.1.37719 WP_000561983.1.37761 WP_000561983.1.37775 WP_000561983.1.37777 WP_000561983.1.3778 WP_000561983.1.378 WP_000561983.1.37808 WP_000561983.1.37848 WP_000561983.1.37864 WP_000561983.1.379 WP_000561983.1.3790 WP_000561983.1.37911 WP_000561983.1.37941 WP_000561983.1.37965 WP_000561983.1.37968 WP_000561983.1.37978 WP_000561983.1.37985 WP_000561983.1.38001 WP_000561983.1.38026 WP_000561983.1.38037 WP_000561983.1.38047 WP_000561983.1.38055 WP_000561983.1.38061 WP_000561983.1.38064 WP_000561983.1.38108 WP_000561983.1.38113 WP_000561983.1.38125 WP_000561983.1.38145 WP_000561983.1.3816 WP_000561983.1.38199 WP_000561983.1.38207 WP_000561983.1.38261 WP_000561983.1.38266 WP_000561983.1.38273 WP_000561983.1.3828 WP_000561983.1.383 WP_000561983.1.38310 WP_000561983.1.38322 WP_000561983.1.3834 WP_000561983.1.38341 WP_000561983.1.38344 WP_000561983.1.38349 WP_000561983.1.38351 WP_000561983.1.3838 WP_000561983.1.38381 WP_000561983.1.38393 WP_000561983.1.38404 WP_000561983.1.38408 WP_000561983.1.38440 WP_000561983.1.3848 WP_000561983.1.38486 WP_000561983.1.38512 WP_000561983.1.38515 WP_000561983.1.38569 WP_000561983.1.38595 WP_000561983.1.3860 WP_000561983.1.38609 WP_000561983.1.38613 WP_000561983.1.38622 WP_000561983.1.38642 WP_000561983.1.38673 WP_000561983.1.3869 WP_000561983.1.38693 WP_000561983.1.38734 WP_000561983.1.38740 WP_000561983.1.38773 WP_000561983.1.38781 WP_000561983.1.38797 WP_000561983.1.38830 WP_000561983.1.38857 WP_000561983.1.38877 WP_000561983.1.38881 WP_000561983.1.38882 WP_000561983.1.38886 WP_000561983.1.38895 WP_000561983.1.38898 WP_000561983.1.3891 WP_000561983.1.38913 WP_000561983.1.38942 WP_000561983.1.38983 WP_000561983.1.38995 WP_000561983.1.38996 WP_000561983.1.39003 WP_000561983.1.39038 WP_000561983.1.39048 WP_000561983.1.39055 WP_000561983.1.39056 WP_000561983.1.39059 WP_000561983.1.39065 WP_000561983.1.3907 WP_000561983.1.39075 WP_000561983.1.39082 WP_000561983.1.39105 WP_000561983.1.39113 WP_000561983.1.39128 WP_000561983.1.39136 WP_000561983.1.3914 WP_000561983.1.39140 WP_000561983.1.39146 WP_000561983.1.39147 WP_000561983.1.39161 WP_000561983.1.39183 WP_000561983.1.39197 WP_000561983.1.39210 WP_000561983.1.39229 WP_000561983.1.39235 WP_000561983.1.39265 WP_000561983.1.39275 WP_000561983.1.3931 WP_000561983.1.39311 WP_000561983.1.39312 WP_000561983.1.39385 WP_000561983.1.39395 WP_000561983.1.39405 WP_000561983.1.39414 WP_000561983.1.39420 WP_000561983.1.39435 WP_000561983.1.39449 WP_000561983.1.39466 WP_000561983.1.39471 WP_000561983.1.39484 WP_000561983.1.39497 WP_000561983.1.39502 WP_000561983.1.39503 WP_000561983.1.39512 WP_000561983.1.39530 WP_000561983.1.39553 WP_000561983.1.39556 WP_000561983.1.39576 WP_000561983.1.39584 WP_000561983.1.39609 WP_000561983.1.39614 WP_000561983.1.39619 WP_000561983.1.39620 WP_000561983.1.39624 WP_000561983.1.39629 WP_000561983.1.39632 WP_000561983.1.39659 WP_000561983.1.39667 WP_000561983.1.39722 WP_000561983.1.39723 WP_000561983.1.39724 WP_000561983.1.39763 WP_000561983.1.39775 WP_000561983.1.39808 WP_000561983.1.39862 WP_000561983.1.39879 WP_000561983.1.39890 WP_000561983.1.39921 WP_000561983.1.39923 WP_000561983.1.39941 WP_000561983.1.39945 WP_000561983.1.39947 WP_000561983.1.40008 WP_000561983.1.40017 WP_000561983.1.40025 WP_000561983.1.40072 WP_000561983.1.40073 WP_000561983.1.40081 WP_000561983.1.40095 WP_000561983.1.40097 WP_000561983.1.401 WP_000561983.1.4011 WP_000561983.1.40111 WP_000561983.1.40155 WP_000561983.1.40158 WP_000561983.1.40160 WP_000561983.1.40167 WP_000561983.1.40170 WP_000561983.1.40171 WP_000561983.1.40205 WP_000561983.1.40208 WP_000561983.1.40224 WP_000561983.1.40229 WP_000561983.1.40240 WP_000561983.1.40254 WP_000561983.1.40257 WP_000561983.1.40258 WP_000561983.1.40259 WP_000561983.1.40279 WP_000561983.1.40284 WP_000561983.1.40292 WP_000561983.1.40305 WP_000561983.1.40307 WP_000561983.1.40311 WP_000561983.1.40341 WP_000561983.1.40361 WP_000561983.1.4037 WP_000561983.1.40374 WP_000561983.1.40380 WP_000561983.1.40395 WP_000561983.1.40414 WP_000561983.1.4042 WP_000561983.1.40465 WP_000561983.1.40467 WP_000561983.1.40492 WP_000561983.1.40493 WP_000561983.1.40496 WP_000561983.1.40508 WP_000561983.1.40517 WP_000561983.1.40528 WP_000561983.1.40533 WP_000561983.1.40577 WP_000561983.1.40583 WP_000561983.1.40605 WP_000561983.1.40622 WP_000561983.1.40648 WP_000561983.1.40693 WP_000561983.1.40695 WP_000561983.1.40698 WP_000561983.1.40710 WP_000561983.1.40722 WP_000561983.1.40745 WP_000561983.1.4075 WP_000561983.1.40750 WP_000561983.1.40763 WP_000561983.1.40771 WP_000561983.1.40788 WP_000561983.1.40849 WP_000561983.1.40854 WP_000561983.1.4087 WP_000561983.1.40877 WP_000561983.1.4088 WP_000561983.1.4089 WP_000561983.1.40910 WP_000561983.1.40924 WP_000561983.1.40930 WP_000561983.1.40932 WP_000561983.1.40935 WP_000561983.1.40946 WP_000561983.1.40973 WP_000561983.1.40979 WP_000561983.1.40996 WP_000561983.1.41004 WP_000561983.1.41017 WP_000561983.1.41018 WP_000561983.1.41048 WP_000561983.1.41050 WP_000561983.1.4106 WP_000561983.1.41070 WP_000561983.1.41074 WP_000561983.1.41075 WP_000561983.1.41086 WP_000561983.1.4109 WP_000561983.1.41091 WP_000561983.1.41097 WP_000561983.1.41116 WP_000561983.1.41128 WP_000561983.1.41132 WP_000561983.1.41176 WP_000561983.1.41192 WP_000561983.1.41225 WP_000561983.1.41226 WP_000561983.1.41251 WP_000561983.1.41258 WP_000561983.1.41265 WP_000561983.1.41277 WP_000561983.1.41279 WP_000561983.1.41299 WP_000561983.1.41305 WP_000561983.1.41308 WP_000561983.1.41310 WP_000561983.1.41321 WP_000561983.1.41333 WP_000561983.1.41335 WP_000561983.1.41345 WP_000561983.1.4136 WP_000561983.1.41375 WP_000561983.1.4141 WP_000561983.1.41415 WP_000561983.1.41427 WP_000561983.1.41434 WP_000561983.1.41438 WP_000561983.1.41440 WP_000561983.1.41459 WP_000561983.1.41468 WP_000561983.1.41497 WP_000561983.1.41498 WP_000561983.1.41516 WP_000561983.1.41519 WP_000561983.1.41524 WP_000561983.1.41528 WP_000561983.1.41554 WP_000561983.1.41572 WP_000561983.1.41591 WP_000561983.1.41593 WP_000561983.1.41610 WP_000561983.1.41628 WP_000561983.1.41631 WP_000561983.1.41658 WP_000561983.1.41659 WP_000561983.1.41662 WP_000561983.1.41688 WP_000561983.1.41690 WP_000561983.1.41708 WP_000561983.1.41716 WP_000561983.1.41724 WP_000561983.1.41735 WP_000561983.1.41746 WP_000561983.1.41761 WP_000561983.1.4178 WP_000561983.1.41789 WP_000561983.1.41799 WP_000561983.1.41802 WP_000561983.1.41824 WP_000561983.1.41825 WP_000561983.1.41836 WP_000561983.1.4184 WP_000561983.1.41859 WP_000561983.1.41862 WP_000561983.1.41877 WP_000561983.1.41882 WP_000561983.1.41894 WP_000561983.1.41897 WP_000561983.1.41904 WP_000561983.1.41911 WP_000561983.1.41919 WP_000561983.1.41929 WP_000561983.1.41931 WP_000561983.1.41938 WP_000561983.1.4194 WP_000561983.1.41949 WP_000561983.1.41978 WP_000561983.1.41979 WP_000561983.1.41985 WP_000561983.1.41994 WP_000561983.1.41998 WP_000561983.1.42009 WP_000561983.1.42069 WP_000561983.1.42081 WP_000561983.1.42090 WP_000561983.1.42104 WP_000561983.1.42109 WP_000561983.1.42111 WP_000561983.1.42136 WP_000561983.1.42156 WP_000561983.1.42187 WP_000561983.1.422 WP_000561983.1.42200 WP_000561983.1.42219 WP_000561983.1.4222 WP_000561983.1.42238 WP_000561983.1.42243 WP_000561983.1.42244 WP_000561983.1.42248 WP_000561983.1.42257 WP_000561983.1.42261 WP_000561983.1.42262 WP_000561983.1.42263 WP_000561983.1.42276 WP_000561983.1.42320 WP_000561983.1.42322 WP_000561983.1.42328 WP_000561983.1.42342 WP_000561983.1.42349 WP_000561983.1.42356 WP_000561983.1.42364 WP_000561983.1.42371 WP_000561983.1.42379 WP_000561983.1.4239 WP_000561983.1.42391 WP_000561983.1.42392 WP_000561983.1.42394 WP_000561983.1.42399 WP_000561983.1.42404 WP_000561983.1.42422 WP_000561983.1.42433 WP_000561983.1.42444 WP_000561983.1.42453 WP_000561983.1.42489 WP_000561983.1.42491 WP_000561983.1.42539 WP_000561983.1.4254 WP_000561983.1.4257 WP_000561983.1.42595 WP_000561983.1.42603 WP_000561983.1.42605 WP_000561983.1.42650 WP_000561983.1.42655 WP_000561983.1.42666 WP_000561983.1.4267 WP_000561983.1.42675 WP_000561983.1.42676 WP_000561983.1.42683 WP_000561983.1.42685 WP_000561983.1.42701 WP_000561983.1.42707 WP_000561983.1.42734 WP_000561983.1.4276 WP_000561983.1.42767 WP_000561983.1.42794 WP_000561983.1.42797 WP_000561983.1.42805 WP_000561983.1.42815 WP_000561983.1.42829 WP_000561983.1.42859 WP_000561983.1.42861 WP_000561983.1.42864 WP_000561983.1.4288 WP_000561983.1.42887 WP_000561983.1.4289 WP_000561983.1.42892 WP_000561983.1.42923 WP_000561983.1.42932 WP_000561983.1.42957 WP_000561983.1.42978 WP_000561983.1.4298 WP_000561983.1.42981 WP_000561983.1.43008 WP_000561983.1.43016 WP_000561983.1.43018 WP_000561983.1.43019 WP_000561983.1.43041 WP_000561983.1.43065 WP_000561983.1.43068 WP_000561983.1.43069 WP_000561983.1.43070 WP_000561983.1.43077 WP_000561983.1.43086 WP_000561983.1.43089 WP_000561983.1.43126 WP_000561983.1.43128 WP_000561983.1.43141 WP_000561983.1.43149 WP_000561983.1.43157 WP_000561983.1.43160 WP_000561983.1.43161 WP_000561983.1.43190 WP_000561983.1.43198 WP_000561983.1.43201 WP_000561983.1.43244 WP_000561983.1.43258 WP_000561983.1.4326 WP_000561983.1.43272 WP_000561983.1.43276 WP_000561983.1.43290 WP_000561983.1.43292 WP_000561983.1.43299 WP_000561983.1.43307 WP_000561983.1.43312 WP_000561983.1.4332 WP_000561983.1.43334 WP_000561983.1.43339 WP_000561983.1.43351 WP_000561983.1.43371 WP_000561983.1.43437 WP_000561983.1.43438 WP_000561983.1.4344 WP_000561983.1.43441 WP_000561983.1.43476 WP_000561983.1.43508 WP_000561983.1.43513 WP_000561983.1.43520 WP_000561983.1.43522 WP_000561983.1.43528 WP_000561983.1.43535 WP_000561983.1.43606 WP_000561983.1.43613 WP_000561983.1.43633 WP_000561983.1.43637 WP_000561983.1.43651 WP_000561983.1.43654 WP_000561983.1.43668 WP_000561983.1.43676 WP_000561983.1.43685 WP_000561983.1.43710 WP_000561983.1.43711 WP_000561983.1.43722 WP_000561983.1.4373 WP_000561983.1.43763 WP_000561983.1.43778 WP_000561983.1.43782 WP_000561983.1.43785 WP_000561983.1.43801 WP_000561983.1.43812 WP_000561983.1.43828 WP_000561983.1.43839 WP_000561983.1.43864 WP_000561983.1.43873 WP_000561983.1.43875 WP_000561983.1.43878 WP_000561983.1.43886 WP_000561983.1.43888 WP_000561983.1.43919 WP_000561983.1.43951 WP_000561983.1.43954 WP_000561983.1.43974 WP_000561983.1.44005 WP_000561983.1.44010 WP_000561983.1.4404 WP_000561983.1.44043 WP_000561983.1.44049 WP_000561983.1.4405 WP_000561983.1.44063 WP_000561983.1.44099 WP_000561983.1.44101 WP_000561983.1.44113 WP_000561983.1.44121 WP_000561983.1.44132 WP_000561983.1.44160 WP_000561983.1.44180 WP_000561983.1.44187 WP_000561983.1.44191 WP_000561983.1.44196 WP_000561983.1.44208 WP_000561983.1.4422 WP_000561983.1.4423 WP_000561983.1.44248 WP_000561983.1.44250 WP_000561983.1.44262 WP_000561983.1.44268 WP_000561983.1.4427 WP_000561983.1.44291 WP_000561983.1.44296 WP_000561983.1.44300 WP_000561983.1.44310 WP_000561983.1.44337 WP_000561983.1.44339 WP_000561983.1.44343 WP_000561983.1.44351 WP_000561983.1.44359 WP_000561983.1.44360 WP_000561983.1.44380 WP_000561983.1.44386 WP_000561983.1.44397 WP_000561983.1.4440 WP_000561983.1.44416 WP_000561983.1.44431 WP_000561983.1.44433 WP_000561983.1.44437 WP_000561983.1.44438 WP_000561983.1.44440 WP_000561983.1.44443 WP_000561983.1.44453 WP_000561983.1.44474 WP_000561983.1.44479 WP_000561983.1.44546 WP_000561983.1.44549 WP_000561983.1.44578 WP_000561983.1.44593 WP_000561983.1.44607 WP_000561983.1.44633 WP_000561983.1.44636 WP_000561983.1.44640 WP_000561983.1.4467 WP_000561983.1.44678 WP_000561983.1.4468 WP_000561983.1.44702 WP_000561983.1.44705 WP_000561983.1.44747 WP_000561983.1.44762 WP_000561983.1.44781 WP_000561983.1.44791 WP_000561983.1.44795 WP_000561983.1.44815 WP_000561983.1.44828 WP_000561983.1.44831 WP_000561983.1.44833 WP_000561983.1.4485 WP_000561983.1.44877 WP_000561983.1.44879 WP_000561983.1.44887 WP_000561983.1.449 WP_000561983.1.44917 WP_000561983.1.44927 WP_000561983.1.44933 WP_000561983.1.44950 WP_000561983.1.44966 WP_000561983.1.44971 WP_000561983.1.44978 WP_000561983.1.44985 WP_000561983.1.44996 WP_000561983.1.44997 WP_000561983.1.44998 WP_000561983.1.4500 WP_000561983.1.4501 WP_000561983.1.45027 WP_000561983.1.45038 WP_000561983.1.45045 WP_000561983.1.45067 WP_000561983.1.45072 WP_000561983.1.45074 WP_000561983.1.45079 WP_000561983.1.45093 WP_000561983.1.45098 WP_000561983.1.45123 WP_000561983.1.45134 WP_000561983.1.45136 WP_000561983.1.45138 WP_000561983.1.45145 WP_000561983.1.45154 WP_000561983.1.45173 WP_000561983.1.45177 WP_000561983.1.45184 WP_000561983.1.45229 WP_000561983.1.45238 WP_000561983.1.45241 WP_000561983.1.45251 WP_000561983.1.45259 WP_000561983.1.45268 WP_000561983.1.45302 WP_000561983.1.4531 WP_000561983.1.45322 WP_000561983.1.45344 WP_000561983.1.45349 WP_000561983.1.45351 WP_000561983.1.45365 WP_000561983.1.4540 WP_000561983.1.45402 WP_000561983.1.45432 WP_000561983.1.45434 WP_000561983.1.45435 WP_000561983.1.45462 WP_000561983.1.45468 WP_000561983.1.45522 WP_000561983.1.45523 WP_000561983.1.45535 WP_000561983.1.45544 WP_000561983.1.45549 WP_000561983.1.45550 WP_000561983.1.45566 WP_000561983.1.45569 WP_000561983.1.45571 WP_000561983.1.45582 WP_000561983.1.45583 WP_000561983.1.45585 WP_000561983.1.45596 WP_000561983.1.45622 WP_000561983.1.45648 WP_000561983.1.45660 WP_000561983.1.45690 WP_000561983.1.45706 WP_000561983.1.45781 WP_000561983.1.45797 WP_000561983.1.458 WP_000561983.1.45829 WP_000561983.1.45844 WP_000561983.1.45848 WP_000561983.1.45871 WP_000561983.1.45906 WP_000561983.1.45918 WP_000561983.1.4592 WP_000561983.1.45943 WP_000561983.1.45973 WP_000561983.1.45984 WP_000561983.1.46011 WP_000561983.1.46028 WP_000561983.1.46030 WP_000561983.1.46069 WP_000561983.1.46077 WP_000561983.1.46091 WP_000561983.1.46112 WP_000561983.1.46124 WP_000561983.1.46169 WP_000561983.1.46173 WP_000561983.1.46174 WP_000561983.1.46187 WP_000561983.1.46203 WP_000561983.1.46205 WP_000561983.1.46215 WP_000561983.1.46225 WP_000561983.1.46232 WP_000561983.1.46241 WP_000561983.1.46243 WP_000561983.1.46250 WP_000561983.1.46278 WP_000561983.1.46286 WP_000561983.1.46299 WP_000561983.1.46303 WP_000561983.1.46307 WP_000561983.1.46322 WP_000561983.1.46323 WP_000561983.1.46345 WP_000561983.1.46355 WP_000561983.1.46358 WP_000561983.1.464 WP_000561983.1.46406 WP_000561983.1.46434 WP_000561983.1.46444 WP_000561983.1.46454 WP_000561983.1.46461 WP_000561983.1.46499 WP_000561983.1.46504 WP_000561983.1.46505 WP_000561983.1.46551 WP_000561983.1.46559 WP_000561983.1.46572 WP_000561983.1.46574 WP_000561983.1.46578 WP_000561983.1.46595 WP_000561983.1.46620 WP_000561983.1.46637 WP_000561983.1.46666 WP_000561983.1.46675 WP_000561983.1.46689 WP_000561983.1.46693 WP_000561983.1.46701 WP_000561983.1.4671 WP_000561983.1.46726 WP_000561983.1.46730 WP_000561983.1.46732 WP_000561983.1.4674 WP_000561983.1.46749 WP_000561983.1.46781 WP_000561983.1.46803 WP_000561983.1.46804 WP_000561983.1.46816 WP_000561983.1.46842 WP_000561983.1.4686 WP_000561983.1.4690 WP_000561983.1.46920 WP_000561983.1.46930 WP_000561983.1.46945 WP_000561983.1.46961 WP_000561983.1.46967 WP_000561983.1.46975 WP_000561983.1.46976 WP_000561983.1.47005 WP_000561983.1.47008 WP_000561983.1.47014 WP_000561983.1.47036 WP_000561983.1.47037 WP_000561983.1.47042 WP_000561983.1.47057 WP_000561983.1.47058 WP_000561983.1.47059 WP_000561983.1.47067 WP_000561983.1.47085 WP_000561983.1.47123 WP_000561983.1.47214 WP_000561983.1.47215 WP_000561983.1.47245 WP_000561983.1.47257 WP_000561983.1.47389 WP_000561983.1.47429 WP_000561983.1.47442 WP_000561983.1.47448 WP_000561983.1.47460 WP_000561983.1.4747 WP_000561983.1.47472 WP_000561983.1.47478 WP_000561983.1.47482 WP_000561983.1.47492 WP_000561983.1.47506 WP_000561983.1.47507 WP_000561983.1.47523 WP_000561983.1.47531 WP_000561983.1.47532 WP_000561983.1.47567 WP_000561983.1.47576 WP_000561983.1.47579 WP_000561983.1.4758 WP_000561983.1.47587 WP_000561983.1.47605 WP_000561983.1.47614 WP_000561983.1.47621 WP_000561983.1.47630 WP_000561983.1.4769 WP_000561983.1.4770 WP_000561983.1.47714 WP_000561983.1.4774 WP_000561983.1.4775 WP_000561983.1.47756 WP_000561983.1.47767 WP_000561983.1.47799 WP_000561983.1.4781 WP_000561983.1.47814 WP_000561983.1.47817 WP_000561983.1.47829 WP_000561983.1.47849 WP_000561983.1.47850 WP_000561983.1.47875 WP_000561983.1.47886 WP_000561983.1.47898 WP_000561983.1.47902 WP_000561983.1.47911 WP_000561983.1.47928 WP_000561983.1.4795 WP_000561983.1.47988 WP_000561983.1.47992 WP_000561983.1.48019 WP_000561983.1.48033 WP_000561983.1.48100 WP_000561983.1.48114 WP_000561983.1.48124 WP_000561983.1.48132 WP_000561983.1.48139 WP_000561983.1.48190 WP_000561983.1.48209 WP_000561983.1.48215 WP_000561983.1.48218 WP_000561983.1.48242 WP_000561983.1.48244 WP_000561983.1.48247 WP_000561983.1.48253 WP_000561983.1.48262 WP_000561983.1.48268 WP_000561983.1.48292 WP_000561983.1.483 WP_000561983.1.48324 WP_000561983.1.48342 WP_000561983.1.48367 WP_000561983.1.48377 WP_000561983.1.4839 WP_000561983.1.48399 WP_000561983.1.48426 WP_000561983.1.48430 WP_000561983.1.48436 WP_000561983.1.48455 WP_000561983.1.48493 WP_000561983.1.48524 WP_000561983.1.4853 WP_000561983.1.48570 WP_000561983.1.48586 WP_000561983.1.4859 WP_000561983.1.48591 WP_000561983.1.48610 WP_000561983.1.48631 WP_000561983.1.48647 WP_000561983.1.48651 WP_000561983.1.48663 WP_000561983.1.48690 WP_000561983.1.48734 WP_000561983.1.48751 WP_000561983.1.48755 WP_000561983.1.48756 WP_000561983.1.48774 WP_000561983.1.48778 WP_000561983.1.48788 WP_000561983.1.48797 WP_000561983.1.48849 WP_000561983.1.4885 WP_000561983.1.48855 WP_000561983.1.48876 WP_000561983.1.48886 WP_000561983.1.48894 WP_000561983.1.48896 WP_000561983.1.48908 WP_000561983.1.48918 WP_000561983.1.48919 WP_000561983.1.48931 WP_000561983.1.48955 WP_000561983.1.48963 WP_000561983.1.48973 WP_000561983.1.48985 WP_000561983.1.49004 WP_000561983.1.49005 WP_000561983.1.49012 WP_000561983.1.49084 WP_000561983.1.49090 WP_000561983.1.49102 WP_000561983.1.49106 WP_000561983.1.49113 WP_000561983.1.49117 WP_000561983.1.49121 WP_000561983.1.4914 WP_000561983.1.49140 WP_000561983.1.49153 WP_000561983.1.49155 WP_000561983.1.49162 WP_000561983.1.49166 WP_000561983.1.49175 WP_000561983.1.49204 WP_000561983.1.49214 WP_000561983.1.49226 WP_000561983.1.49233 WP_000561983.1.49239 WP_000561983.1.49256 WP_000561983.1.49262 WP_000561983.1.49274 WP_000561983.1.49276 WP_000561983.1.49290 WP_000561983.1.49302 WP_000561983.1.49304 WP_000561983.1.49309 WP_000561983.1.49311 WP_000561983.1.49334 WP_000561983.1.49340 WP_000561983.1.49355 WP_000561983.1.49358 WP_000561983.1.49366 WP_000561983.1.49375 WP_000561983.1.49429 WP_000561983.1.49434 WP_000561983.1.49443 WP_000561983.1.49450 WP_000561983.1.49472 WP_000561983.1.49490 WP_000561983.1.495 WP_000561983.1.49515 WP_000561983.1.49534 WP_000561983.1.49545 WP_000561983.1.49550 WP_000561983.1.49572 WP_000561983.1.49574 WP_000561983.1.49590 WP_000561983.1.49595 WP_000561983.1.49602 WP_000561983.1.49630 WP_000561983.1.49647 WP_000561983.1.49650 WP_000561983.1.49686 WP_000561983.1.49703 WP_000561983.1.49710 WP_000561983.1.49769 WP_000561983.1.49770 WP_000561983.1.49778 WP_000561983.1.49780 WP_000561983.1.4979 WP_000561983.1.49803 WP_000561983.1.49805 WP_000561983.1.49827 WP_000561983.1.49846 WP_000561983.1.49848 WP_000561983.1.4991 WP_000561983.1.49929 WP_000561983.1.49931 WP_000561983.1.49947 WP_000561983.1.49959 WP_000561983.1.49997 WP_000561983.1.50 WP_000561983.1.50003 WP_000561983.1.50007 WP_000561983.1.50014 WP_000561983.1.50030 WP_000561983.1.50043 WP_000561983.1.50080 WP_000561983.1.5009 WP_000561983.1.50103 WP_000561983.1.50128 WP_000561983.1.50158 WP_000561983.1.50161 WP_000561983.1.50198 WP_000561983.1.50211 WP_000561983.1.50238 WP_000561983.1.50239 WP_000561983.1.50247 WP_000561983.1.50251 WP_000561983.1.50285 WP_000561983.1.50308 WP_000561983.1.50309 WP_000561983.1.50332 WP_000561983.1.50349 WP_000561983.1.50374 WP_000561983.1.50376 WP_000561983.1.50386 WP_000561983.1.50387 WP_000561983.1.50389 WP_000561983.1.50404 WP_000561983.1.50406 WP_000561983.1.50413 WP_000561983.1.50449 WP_000561983.1.50468 WP_000561983.1.50469 WP_000561983.1.50478 WP_000561983.1.50480 WP_000561983.1.5051 WP_000561983.1.50517 WP_000561983.1.50563 WP_000561983.1.50565 WP_000561983.1.50566 WP_000561983.1.50570 WP_000561983.1.50576 WP_000561983.1.5058 WP_000561983.1.50593 WP_000561983.1.50626 WP_000561983.1.50652 WP_000561983.1.50676 WP_000561983.1.50684 WP_000561983.1.50726 WP_000561983.1.50769 WP_000561983.1.50771 WP_000561983.1.50774 WP_000561983.1.50782 WP_000561983.1.50800 WP_000561983.1.50804 WP_000561983.1.50808 WP_000561983.1.50875 WP_000561983.1.5088 WP_000561983.1.50882 WP_000561983.1.50885 WP_000561983.1.50893 WP_000561983.1.509 WP_000561983.1.50905 WP_000561983.1.50908 WP_000561983.1.50918 WP_000561983.1.50929 WP_000561983.1.50941 WP_000561983.1.50954 WP_000561983.1.50960 WP_000561983.1.50970 WP_000561983.1.50999 WP_000561983.1.51014 WP_000561983.1.51022 WP_000561983.1.51025 WP_000561983.1.51036 WP_000561983.1.51040 WP_000561983.1.51048 WP_000561983.1.51066 WP_000561983.1.51100 WP_000561983.1.51117 WP_000561983.1.51131 WP_000561983.1.51134 WP_000561983.1.51139 WP_000561983.1.5114 WP_000561983.1.51162 WP_000561983.1.51178 WP_000561983.1.51179 WP_000561983.1.51182 WP_000561983.1.51186 WP_000561983.1.51224 WP_000561983.1.51227 WP_000561983.1.5125 WP_000561983.1.5127 WP_000561983.1.51285 WP_000561983.1.51305 WP_000561983.1.51308 WP_000561983.1.51315 WP_000561983.1.51331 WP_000561983.1.51338 WP_000561983.1.51356 WP_000561983.1.5136 WP_000561983.1.5138 WP_000561983.1.51394 WP_000561983.1.51412 WP_000561983.1.51414 WP_000561983.1.51419 WP_000561983.1.51451 WP_000561983.1.51458 WP_000561983.1.51464 WP_000561983.1.51474 WP_000561983.1.51487 WP_000561983.1.51488 WP_000561983.1.51502 WP_000561983.1.51506 WP_000561983.1.51514 WP_000561983.1.51518 WP_000561983.1.51519 WP_000561983.1.51555 WP_000561983.1.51594 WP_000561983.1.51598 WP_000561983.1.51611 WP_000561983.1.51613 WP_000561983.1.51615 WP_000561983.1.51634 WP_000561983.1.51642 WP_000561983.1.51644 WP_000561983.1.51649 WP_000561983.1.51686 WP_000561983.1.51700 WP_000561983.1.51704 WP_000561983.1.51724 WP_000561983.1.51734 WP_000561983.1.51756 WP_000561983.1.51764 WP_000561983.1.51810 WP_000561983.1.51831 WP_000561983.1.51838 WP_000561983.1.51841 WP_000561983.1.51863 WP_000561983.1.51868 WP_000561983.1.51888 WP_000561983.1.51900 WP_000561983.1.51910 WP_000561983.1.51911 WP_000561983.1.51914 WP_000561983.1.51915 WP_000561983.1.51930 WP_000561983.1.51932 WP_000561983.1.51935 WP_000561983.1.51989 WP_000561983.1.51994 WP_000561983.1.520 WP_000561983.1.52047 WP_000561983.1.52057 WP_000561983.1.5211 WP_000561983.1.52114 WP_000561983.1.52121 WP_000561983.1.52123 WP_000561983.1.52129 WP_000561983.1.52148 WP_000561983.1.52156 WP_000561983.1.5216 WP_000561983.1.52161 WP_000561983.1.52170 WP_000561983.1.52191 WP_000561983.1.52202 WP_000561983.1.52209 WP_000561983.1.52255 WP_000561983.1.52301 WP_000561983.1.52321 WP_000561983.1.52336 WP_000561983.1.52339 WP_000561983.1.52346 WP_000561983.1.52353 WP_000561983.1.52356 WP_000561983.1.52361 WP_000561983.1.52438 WP_000561983.1.52446 WP_000561983.1.52456 WP_000561983.1.52469 WP_000561983.1.52527 WP_000561983.1.52528 WP_000561983.1.52571 WP_000561983.1.52582 WP_000561983.1.52586 WP_000561983.1.526 WP_000561983.1.52637 WP_000561983.1.52647 WP_000561983.1.52653 WP_000561983.1.52656 WP_000561983.1.52675 WP_000561983.1.52692 WP_000561983.1.5273 WP_000561983.1.52738 WP_000561983.1.52742 WP_000561983.1.52743 WP_000561983.1.52744 WP_000561983.1.52748 WP_000561983.1.52773 WP_000561983.1.52795 WP_000561983.1.52807 WP_000561983.1.52824 WP_000561983.1.52833 WP_000561983.1.52851 WP_000561983.1.52857 WP_000561983.1.52858 WP_000561983.1.52866 WP_000561983.1.52887 WP_000561983.1.52898 WP_000561983.1.52910 WP_000561983.1.52924 WP_000561983.1.52949 WP_000561983.1.52985 WP_000561983.1.5301 WP_000561983.1.53016 WP_000561983.1.53092 WP_000561983.1.53100 WP_000561983.1.53107 WP_000561983.1.53119 WP_000561983.1.5313 WP_000561983.1.53141 WP_000561983.1.53151 WP_000561983.1.53154 WP_000561983.1.53158 WP_000561983.1.53159 WP_000561983.1.5316 WP_000561983.1.53179 WP_000561983.1.53190 WP_000561983.1.53198 WP_000561983.1.53203 WP_000561983.1.53206 WP_000561983.1.53210 WP_000561983.1.53233 WP_000561983.1.53234 WP_000561983.1.53272 WP_000561983.1.53274 WP_000561983.1.53286 WP_000561983.1.53307 WP_000561983.1.53315 WP_000561983.1.53316 WP_000561983.1.53321 WP_000561983.1.53328 WP_000561983.1.5333 WP_000561983.1.53362 WP_000561983.1.53368 WP_000561983.1.53375 WP_000561983.1.53385 WP_000561983.1.53406 WP_000561983.1.53436 WP_000561983.1.53450 WP_000561983.1.53454 WP_000561983.1.53466 WP_000561983.1.5349 WP_000561983.1.53529 WP_000561983.1.53534 WP_000561983.1.53540 WP_000561983.1.53543 WP_000561983.1.53555 WP_000561983.1.53559 WP_000561983.1.5356 WP_000561983.1.53567 WP_000561983.1.53571 WP_000561983.1.5358 WP_000561983.1.53664 WP_000561983.1.53675 WP_000561983.1.53688 WP_000561983.1.53692 WP_000561983.1.53694 WP_000561983.1.53696 WP_000561983.1.53723 WP_000561983.1.5374 WP_000561983.1.53750 WP_000561983.1.53757 WP_000561983.1.53772 WP_000561983.1.53778 WP_000561983.1.53781 WP_000561983.1.53790 WP_000561983.1.53800 WP_000561983.1.53812 WP_000561983.1.53814 WP_000561983.1.53815 WP_000561983.1.53839 WP_000561983.1.53892 WP_000561983.1.53896 WP_000561983.1.53898 WP_000561983.1.53902 WP_000561983.1.53905 WP_000561983.1.5392 WP_000561983.1.53935 WP_000561983.1.53958 WP_000561983.1.53961 WP_000561983.1.53981 WP_000561983.1.53984 WP_000561983.1.54033 WP_000561983.1.54061 WP_000561983.1.54068 WP_000561983.1.54075 WP_000561983.1.54082 WP_000561983.1.54085 WP_000561983.1.54132 WP_000561983.1.54136 WP_000561983.1.5415 WP_000561983.1.54170 WP_000561983.1.54175 WP_000561983.1.54196 WP_000561983.1.542 WP_000561983.1.54203 WP_000561983.1.54209 WP_000561983.1.54259 WP_000561983.1.54271 WP_000561983.1.54273 WP_000561983.1.54274 WP_000561983.1.54283 WP_000561983.1.5430 WP_000561983.1.54319 WP_000561983.1.54324 WP_000561983.1.54333 WP_000561983.1.54364 WP_000561983.1.54366 WP_000561983.1.54371 WP_000561983.1.54400 WP_000561983.1.54431 WP_000561983.1.54442 WP_000561983.1.54469 WP_000561983.1.54482 WP_000561983.1.54500 WP_000561983.1.54522 WP_000561983.1.54526 WP_000561983.1.54558 WP_000561983.1.5456 WP_000561983.1.54569 WP_000561983.1.54589 WP_000561983.1.5459 WP_000561983.1.54607 WP_000561983.1.54615 WP_000561983.1.54644 WP_000561983.1.54662 WP_000561983.1.54667 WP_000561983.1.54678 WP_000561983.1.54681 WP_000561983.1.54694 WP_000561983.1.54722 WP_000561983.1.54748 WP_000561983.1.54749 WP_000561983.1.54764 WP_000561983.1.54774 WP_000561983.1.5481 WP_000561983.1.54814 WP_000561983.1.54822 WP_000561983.1.54827 WP_000561983.1.54833 WP_000561983.1.54845 WP_000561983.1.5485 WP_000561983.1.54865 WP_000561983.1.54877 WP_000561983.1.5493 WP_000561983.1.54935 WP_000561983.1.54936 WP_000561983.1.54979 WP_000561983.1.54984 WP_000561983.1.54992 WP_000561983.1.55008 WP_000561983.1.55010 WP_000561983.1.55034 WP_000561983.1.55073 WP_000561983.1.55152 WP_000561983.1.55156 WP_000561983.1.55163 WP_000561983.1.55165 WP_000561983.1.55166 WP_000561983.1.5517 WP_000561983.1.55178 WP_000561983.1.55215 WP_000561983.1.55223 WP_000561983.1.55224 WP_000561983.1.5523 WP_000561983.1.5525 WP_000561983.1.55285 WP_000561983.1.55290 WP_000561983.1.55294 WP_000561983.1.55310 WP_000561983.1.55317 WP_000561983.1.55325 WP_000561983.1.55361 WP_000561983.1.55379 WP_000561983.1.5539 WP_000561983.1.55418 WP_000561983.1.55430 WP_000561983.1.55461 WP_000561983.1.55468 WP_000561983.1.55475 WP_000561983.1.55477 WP_000561983.1.55496 WP_000561983.1.55500 WP_000561983.1.55506 WP_000561983.1.5552 WP_000561983.1.55528 WP_000561983.1.55545 WP_000561983.1.5555 WP_000561983.1.55554 WP_000561983.1.55557 WP_000561983.1.55559 WP_000561983.1.5560 WP_000561983.1.55604 WP_000561983.1.55614 WP_000561983.1.55623 WP_000561983.1.55639 WP_000561983.1.55640 WP_000561983.1.55647 WP_000561983.1.55672 WP_000561983.1.55680 WP_000561983.1.55699 WP_000561983.1.55706 WP_000561983.1.55718 WP_000561983.1.5572 WP_000561983.1.55725 WP_000561983.1.55743 WP_000561983.1.55768 WP_000561983.1.5577 WP_000561983.1.55780 WP_000561983.1.55782 WP_000561983.1.55796 WP_000561983.1.55803 WP_000561983.1.55853 WP_000561983.1.55923 WP_000561983.1.55948 WP_000561983.1.55967 WP_000561983.1.55973 WP_000561983.1.55993 WP_000561983.1.55995 WP_000561983.1.56002 WP_000561983.1.56004 WP_000561983.1.56012 WP_000561983.1.56026 WP_000561983.1.56059 WP_000561983.1.56069 WP_000561983.1.56082 WP_000561983.1.56097 WP_000561983.1.56100 WP_000561983.1.56105 WP_000561983.1.56130 WP_000561983.1.56144 WP_000561983.1.56152 WP_000561983.1.56172 WP_000561983.1.5621 WP_000561983.1.56222 WP_000561983.1.56226 WP_000561983.1.56235 WP_000561983.1.56238 WP_000561983.1.56244 WP_000561983.1.56247 WP_000561983.1.56261 WP_000561983.1.56263 WP_000561983.1.56286 WP_000561983.1.56303 WP_000561983.1.56304 WP_000561983.1.56305 WP_000561983.1.56311 WP_000561983.1.5633 WP_000561983.1.56354 WP_000561983.1.56368 WP_000561983.1.56370 WP_000561983.1.56385 WP_000561983.1.56389 WP_000561983.1.56393 WP_000561983.1.56413 WP_000561983.1.56414 WP_000561983.1.56419 WP_000561983.1.56420 WP_000561983.1.56423 WP_000561983.1.56438 WP_000561983.1.56459 WP_000561983.1.56468 WP_000561983.1.56512 WP_000561983.1.56514 WP_000561983.1.56535 WP_000561983.1.56559 WP_000561983.1.56560 WP_000561983.1.56585 WP_000561983.1.56597 WP_000561983.1.56601 WP_000561983.1.56614 WP_000561983.1.56615 WP_000561983.1.56640 WP_000561983.1.56642 WP_000561983.1.56647 WP_000561983.1.56651 WP_000561983.1.56660 WP_000561983.1.56671 WP_000561983.1.5668 WP_000561983.1.56682 WP_000561983.1.56724 WP_000561983.1.56824 WP_000561983.1.56825 WP_000561983.1.56851 WP_000561983.1.56861 WP_000561983.1.56875 WP_000561983.1.56877 WP_000561983.1.56887 WP_000561983.1.56889 WP_000561983.1.56893 WP_000561983.1.56898 WP_000561983.1.56905 WP_000561983.1.56950 WP_000561983.1.56981 WP_000561983.1.57000 WP_000561983.1.57026 WP_000561983.1.57039 WP_000561983.1.57056 WP_000561983.1.57076 WP_000561983.1.57084 WP_000561983.1.57101 WP_000561983.1.5711 WP_000561983.1.57125 WP_000561983.1.57137 WP_000561983.1.57143 WP_000561983.1.57147 WP_000561983.1.57149 WP_000561983.1.57168 WP_000561983.1.57179 WP_000561983.1.57186 WP_000561983.1.57187 WP_000561983.1.57232 WP_000561983.1.57233 WP_000561983.1.57246 WP_000561983.1.57296 WP_000561983.1.57307 WP_000561983.1.57342 WP_000561983.1.57344 WP_000561983.1.57356 WP_000561983.1.57357 WP_000561983.1.57362 WP_000561983.1.57377 WP_000561983.1.57399 WP_000561983.1.57418 WP_000561983.1.57433 WP_000561983.1.57494 WP_000561983.1.57495 WP_000561983.1.57510 WP_000561983.1.57515 WP_000561983.1.57521 WP_000561983.1.57529 WP_000561983.1.5753 WP_000561983.1.57534 WP_000561983.1.57555 WP_000561983.1.57559 WP_000561983.1.57576 WP_000561983.1.57601 WP_000561983.1.57607 WP_000561983.1.57631 WP_000561983.1.57641 WP_000561983.1.57684 WP_000561983.1.57699 WP_000561983.1.57709 WP_000561983.1.57710 WP_000561983.1.57735 WP_000561983.1.5774 WP_000561983.1.57763 WP_000561983.1.57778 WP_000561983.1.57781 WP_000561983.1.57785 WP_000561983.1.57797 WP_000561983.1.57800 WP_000561983.1.5781 WP_000561983.1.57835 WP_000561983.1.57857 WP_000561983.1.57862 WP_000561983.1.57873 WP_000561983.1.57890 WP_000561983.1.57891 WP_000561983.1.57893 WP_000561983.1.57965 WP_000561983.1.57972 WP_000561983.1.57978 WP_000561983.1.58008 WP_000561983.1.5801 WP_000561983.1.58040 WP_000561983.1.58041 WP_000561983.1.58044 WP_000561983.1.58053 WP_000561983.1.58081 WP_000561983.1.5809 WP_000561983.1.58090 WP_000561983.1.58131 WP_000561983.1.58132 WP_000561983.1.58144 WP_000561983.1.58153 WP_000561983.1.58157 WP_000561983.1.58173 WP_000561983.1.58191 WP_000561983.1.58194 WP_000561983.1.58239 WP_000561983.1.58249 WP_000561983.1.58251 WP_000561983.1.58252 WP_000561983.1.58261 WP_000561983.1.58274 WP_000561983.1.5828 WP_000561983.1.58282 WP_000561983.1.58290 WP_000561983.1.58301 WP_000561983.1.58324 WP_000561983.1.58326 WP_000561983.1.58334 WP_000561983.1.58357 WP_000561983.1.58358 WP_000561983.1.5836 WP_000561983.1.58372 WP_000561983.1.58407 WP_000561983.1.58416 WP_000561983.1.58418 WP_000561983.1.58442 WP_000561983.1.58443 WP_000561983.1.58451 WP_000561983.1.5846 WP_000561983.1.58485 WP_000561983.1.58486 WP_000561983.1.58489 WP_000561983.1.58537 WP_000561983.1.5854 WP_000561983.1.58548 WP_000561983.1.58564 WP_000561983.1.58568 WP_000561983.1.5858 WP_000561983.1.58583 WP_000561983.1.58604 WP_000561983.1.58633 WP_000561983.1.58648 WP_000561983.1.58652 WP_000561983.1.58662 WP_000561983.1.58663 WP_000561983.1.58669 WP_000561983.1.58675 WP_000561983.1.58698 WP_000561983.1.587 WP_000561983.1.58724 WP_000561983.1.58729 WP_000561983.1.58744 WP_000561983.1.58745 WP_000561983.1.58749 WP_000561983.1.5875 WP_000561983.1.58770 WP_000561983.1.5878 WP_000561983.1.58796 WP_000561983.1.58803 WP_000561983.1.58807 WP_000561983.1.58831 WP_000561983.1.58834 WP_000561983.1.58836 WP_000561983.1.58847 WP_000561983.1.5886 WP_000561983.1.58861 WP_000561983.1.58883 WP_000561983.1.58884 WP_000561983.1.58898 WP_000561983.1.58926 WP_000561983.1.58932 WP_000561983.1.58949 WP_000561983.1.58963 WP_000561983.1.58970 WP_000561983.1.58974 WP_000561983.1.59006 WP_000561983.1.59012 WP_000561983.1.59020 WP_000561983.1.59043 WP_000561983.1.59056 WP_000561983.1.59061 WP_000561983.1.59064 WP_000561983.1.59084 WP_000561983.1.59094 WP_000561983.1.59097 WP_000561983.1.59125 WP_000561983.1.59136 WP_000561983.1.59142 WP_000561983.1.59148 WP_000561983.1.59163 WP_000561983.1.59224 WP_000561983.1.59236 WP_000561983.1.59282 WP_000561983.1.5929 WP_000561983.1.59294 WP_000561983.1.59295 WP_000561983.1.59299 WP_000561983.1.59313 WP_000561983.1.59321 WP_000561983.1.59335 WP_000561983.1.59336 WP_000561983.1.59375 WP_000561983.1.59381 WP_000561983.1.59412 WP_000561983.1.59420 WP_000561983.1.59427 WP_000561983.1.59439 WP_000561983.1.59458 WP_000561983.1.59486 WP_000561983.1.5949 WP_000561983.1.59490 WP_000561983.1.59501 WP_000561983.1.59508 WP_000561983.1.59510 WP_000561983.1.59512 WP_000561983.1.59521 WP_000561983.1.5953 WP_000561983.1.59538 WP_000561983.1.59548 WP_000561983.1.59562 WP_000561983.1.59587 WP_000561983.1.59604 WP_000561983.1.59636 WP_000561983.1.59641 WP_000561983.1.59646 WP_000561983.1.59648 WP_000561983.1.59684 WP_000561983.1.5969 WP_000561983.1.59694 WP_000561983.1.59709 WP_000561983.1.59710 WP_000561983.1.59751 WP_000561983.1.59755 WP_000561983.1.59771 WP_000561983.1.5979 WP_000561983.1.59827 WP_000561983.1.59829 WP_000561983.1.59830 WP_000561983.1.59847 WP_000561983.1.59848 WP_000561983.1.59863 WP_000561983.1.59928 WP_000561983.1.5993 WP_000561983.1.59933 WP_000561983.1.59953 WP_000561983.1.59969 WP_000561983.1.59979 WP_000561983.1.59994 WP_000561983.1.60004 WP_000561983.1.60008 WP_000561983.1.60015 WP_000561983.1.60021 WP_000561983.1.60045 WP_000561983.1.60052 WP_000561983.1.60069 WP_000561983.1.60076 WP_000561983.1.60106 WP_000561983.1.60114 WP_000561983.1.60126 WP_000561983.1.60137 WP_000561983.1.60140 WP_000561983.1.60154 WP_000561983.1.60155 WP_000561983.1.60168 WP_000561983.1.60192 WP_000561983.1.60199 WP_000561983.1.60209 WP_000561983.1.60212 WP_000561983.1.60213 WP_000561983.1.60226 WP_000561983.1.60231 WP_000561983.1.60253 WP_000561983.1.60285 WP_000561983.1.60320 WP_000561983.1.60322 WP_000561983.1.60324 WP_000561983.1.6033 WP_000561983.1.60330 WP_000561983.1.60356 WP_000561983.1.60370 WP_000561983.1.60379 WP_000561983.1.6038 WP_000561983.1.60380 WP_000561983.1.6041 WP_000561983.1.60424 WP_000561983.1.60425 WP_000561983.1.60464 WP_000561983.1.60469 WP_000561983.1.60481 WP_000561983.1.605 WP_000561983.1.60503 WP_000561983.1.60507 WP_000561983.1.6052 WP_000561983.1.60545 WP_000561983.1.60560 WP_000561983.1.60561 WP_000561983.1.6058 WP_000561983.1.60584 WP_000561983.1.60597 WP_000561983.1.6060 WP_000561983.1.60608 WP_000561983.1.60622 WP_000561983.1.60643 WP_000561983.1.60661 WP_000561983.1.60676 WP_000561983.1.60708 WP_000561983.1.60713 WP_000561983.1.60725 WP_000561983.1.60746 WP_000561983.1.60760 WP_000561983.1.60772 WP_000561983.1.60783 WP_000561983.1.60792 WP_000561983.1.60794 WP_000561983.1.608 WP_000561983.1.60807 WP_000561983.1.60838 WP_000561983.1.60851 WP_000561983.1.60855 WP_000561983.1.60857 WP_000561983.1.6086 WP_000561983.1.60863 WP_000561983.1.60866 WP_000561983.1.60874 WP_000561983.1.60882 WP_000561983.1.60889 WP_000561983.1.60897 WP_000561983.1.6090 WP_000561983.1.60918 WP_000561983.1.60919 WP_000561983.1.60926 WP_000561983.1.60930 WP_000561983.1.60941 WP_000561983.1.60950 WP_000561983.1.60976 WP_000561983.1.60988 WP_000561983.1.60990 WP_000561983.1.6104 WP_000561983.1.61044 WP_000561983.1.61045 WP_000561983.1.61076 WP_000561983.1.61078 WP_000561983.1.6108 WP_000561983.1.61087 WP_000561983.1.61114 WP_000561983.1.61123 WP_000561983.1.6114 WP_000561983.1.61146 WP_000561983.1.61147 WP_000561983.1.61168 WP_000561983.1.61184 WP_000561983.1.61200 WP_000561983.1.61201 WP_000561983.1.61210 WP_000561983.1.61218 WP_000561983.1.61232 WP_000561983.1.61233 WP_000561983.1.6126 WP_000561983.1.6129 WP_000561983.1.61296 WP_000561983.1.61345 WP_000561983.1.61356 WP_000561983.1.61357 WP_000561983.1.61381 WP_000561983.1.61417 WP_000561983.1.61434 WP_000561983.1.61497 WP_000561983.1.61501 WP_000561983.1.61509 WP_000561983.1.61511 WP_000561983.1.61519 WP_000561983.1.61539 WP_000561983.1.61542 WP_000561983.1.61553 WP_000561983.1.61574 WP_000561983.1.61582 WP_000561983.1.61594 WP_000561983.1.61595 WP_000561983.1.61609 WP_000561983.1.6164 WP_000561983.1.61649 WP_000561983.1.61652 WP_000561983.1.61662 WP_000561983.1.61667 WP_000561983.1.61671 WP_000561983.1.61697 WP_000561983.1.61712 WP_000561983.1.61714 WP_000561983.1.61730 WP_000561983.1.61732 WP_000561983.1.61737 WP_000561983.1.61743 WP_000561983.1.61783 WP_000561983.1.61809 WP_000561983.1.61857 WP_000561983.1.61877 WP_000561983.1.6190 WP_000561983.1.61908 WP_000561983.1.61918 WP_000561983.1.61920 WP_000561983.1.61922 WP_000561983.1.61924 WP_000561983.1.61952 WP_000561983.1.61968 WP_000561983.1.62007 WP_000561983.1.62020 WP_000561983.1.62025 WP_000561983.1.62076 WP_000561983.1.6209 WP_000561983.1.6210 WP_000561983.1.62108 WP_000561983.1.62120 WP_000561983.1.62122 WP_000561983.1.62124 WP_000561983.1.62142 WP_000561983.1.62144 WP_000561983.1.62158 WP_000561983.1.62184 WP_000561983.1.62199 WP_000561983.1.62201 WP_000561983.1.62204 WP_000561983.1.62210 WP_000561983.1.62219 WP_000561983.1.62222 WP_000561983.1.62223 WP_000561983.1.62241 WP_000561983.1.62245 WP_000561983.1.62257 WP_000561983.1.62271 WP_000561983.1.62302 WP_000561983.1.62304 WP_000561983.1.62310 WP_000561983.1.62314 WP_000561983.1.62323 WP_000561983.1.62333 WP_000561983.1.62338 WP_000561983.1.62339 WP_000561983.1.62344 WP_000561983.1.62364 WP_000561983.1.62374 WP_000561983.1.62380 WP_000561983.1.62403 WP_000561983.1.62407 WP_000561983.1.62411 WP_000561983.1.62412 WP_000561983.1.62436 WP_000561983.1.62442 WP_000561983.1.62475 WP_000561983.1.62486 WP_000561983.1.62488 WP_000561983.1.62504 WP_000561983.1.62522 WP_000561983.1.6253 WP_000561983.1.62536 WP_000561983.1.62564 WP_000561983.1.62570 WP_000561983.1.62619 WP_000561983.1.62640 WP_000561983.1.62648 WP_000561983.1.62669 WP_000561983.1.62677 WP_000561983.1.62686 WP_000561983.1.62693 WP_000561983.1.627 WP_000561983.1.62725 WP_000561983.1.62745 WP_000561983.1.62751 WP_000561983.1.62757 WP_000561983.1.62798 WP_000561983.1.62825 WP_000561983.1.62828 WP_000561983.1.62853 WP_000561983.1.62903 WP_000561983.1.62910 WP_000561983.1.62913 WP_000561983.1.6292 WP_000561983.1.62932 WP_000561983.1.62955 WP_000561983.1.62960 WP_000561983.1.62976 WP_000561983.1.62983 WP_000561983.1.62988 WP_000561983.1.63016 WP_000561983.1.63025 WP_000561983.1.63043 WP_000561983.1.63045 WP_000561983.1.63063 WP_000561983.1.63069 WP_000561983.1.63087 WP_000561983.1.63102 WP_000561983.1.63118 WP_000561983.1.63129 WP_000561983.1.63135 WP_000561983.1.63150 WP_000561983.1.63155 WP_000561983.1.63169 WP_000561983.1.63181 WP_000561983.1.63186 WP_000561983.1.63203 WP_000561983.1.63229 WP_000561983.1.63234 WP_000561983.1.63243 WP_000561983.1.63250 WP_000561983.1.63256 WP_000561983.1.63290 WP_000561983.1.63297 WP_000561983.1.63358 WP_000561983.1.63362 WP_000561983.1.63382 WP_000561983.1.63422 WP_000561983.1.63432 WP_000561983.1.63448 WP_000561983.1.63455 WP_000561983.1.63461 WP_000561983.1.63479 WP_000561983.1.63497 WP_000561983.1.63499 WP_000561983.1.63509 WP_000561983.1.63513 WP_000561983.1.63514 WP_000561983.1.63525 WP_000561983.1.63529 WP_000561983.1.63532 WP_000561983.1.63548 WP_000561983.1.63568 WP_000561983.1.6357 WP_000561983.1.63577 WP_000561983.1.63583 WP_000561983.1.63585 WP_000561983.1.63592 WP_000561983.1.63603 WP_000561983.1.63633 WP_000561983.1.63663 WP_000561983.1.63664 WP_000561983.1.6367 WP_000561983.1.63677 WP_000561983.1.63690 WP_000561983.1.6370 WP_000561983.1.63718 WP_000561983.1.63731 WP_000561983.1.63736 WP_000561983.1.63748 WP_000561983.1.6375 WP_000561983.1.63757 WP_000561983.1.63766 WP_000561983.1.63781 WP_000561983.1.63782 WP_000561983.1.63797 WP_000561983.1.63816 WP_000561983.1.63824 WP_000561983.1.63831 WP_000561983.1.63834 WP_000561983.1.6384 WP_000561983.1.63851 WP_000561983.1.63860 WP_000561983.1.63863 WP_000561983.1.63864 WP_000561983.1.63866 WP_000561983.1.63876 WP_000561983.1.6389 WP_000561983.1.63901 WP_000561983.1.63903 WP_000561983.1.63912 WP_000561983.1.63934 WP_000561983.1.63955 WP_000561983.1.63958 WP_000561983.1.63963 WP_000561983.1.63977 WP_000561983.1.6399 WP_000561983.1.63992 WP_000561983.1.64007 WP_000561983.1.64010 WP_000561983.1.64018 WP_000561983.1.64032 WP_000561983.1.64034 WP_000561983.1.64046 WP_000561983.1.64072 WP_000561983.1.64085 WP_000561983.1.64087 WP_000561983.1.64103 WP_000561983.1.64109 WP_000561983.1.64121 WP_000561983.1.6415 WP_000561983.1.64157 WP_000561983.1.64176 WP_000561983.1.64208 WP_000561983.1.64217 WP_000561983.1.64229 WP_000561983.1.6423 WP_000561983.1.64242 WP_000561983.1.64244 WP_000561983.1.64266 WP_000561983.1.64293 WP_000561983.1.64294 WP_000561983.1.64332 WP_000561983.1.64350 WP_000561983.1.6437 WP_000561983.1.64374 WP_000561983.1.64376 WP_000561983.1.64385 WP_000561983.1.64387 WP_000561983.1.64389 WP_000561983.1.644 WP_000561983.1.64403 WP_000561983.1.64412 WP_000561983.1.64462 WP_000561983.1.64471 WP_000561983.1.64500 WP_000561983.1.64501 WP_000561983.1.6451 WP_000561983.1.64538 WP_000561983.1.64569 WP_000561983.1.64597 WP_000561983.1.64632 WP_000561983.1.64645 WP_000561983.1.64648 WP_000561983.1.64649 WP_000561983.1.64654 WP_000561983.1.64662 WP_000561983.1.64663 WP_000561983.1.64667 WP_000561983.1.64674 WP_000561983.1.64690 WP_000561983.1.64702 WP_000561983.1.64709 WP_000561983.1.64710 WP_000561983.1.64711 WP_000561983.1.64721 WP_000561983.1.64744 WP_000561983.1.64757 WP_000561983.1.64763 WP_000561983.1.64771 WP_000561983.1.64781 WP_000561983.1.64798 WP_000561983.1.64817 WP_000561983.1.64831 WP_000561983.1.6484 WP_000561983.1.64847 WP_000561983.1.6487 WP_000561983.1.6489 WP_000561983.1.64891 WP_000561983.1.64894 WP_000561983.1.64919 WP_000561983.1.64920 WP_000561983.1.64944 WP_000561983.1.64972 WP_000561983.1.64974 WP_000561983.1.64977 WP_000561983.1.65011 WP_000561983.1.65016 WP_000561983.1.65018 WP_000561983.1.65022 WP_000561983.1.65027 WP_000561983.1.65028 WP_000561983.1.65052 WP_000561983.1.65054 WP_000561983.1.65075 WP_000561983.1.6514 WP_000561983.1.65163 WP_000561983.1.65168 WP_000561983.1.65171 WP_000561983.1.65172 WP_000561983.1.65185 WP_000561983.1.65191 WP_000561983.1.65200 WP_000561983.1.65211 WP_000561983.1.65218 WP_000561983.1.65226 WP_000561983.1.65238 WP_000561983.1.65248 WP_000561983.1.65249 WP_000561983.1.6525 WP_000561983.1.65266 WP_000561983.1.65269 WP_000561983.1.65295 WP_000561983.1.65348 WP_000561983.1.6535 WP_000561983.1.65357 WP_000561983.1.65363 WP_000561983.1.65394 WP_000561983.1.65395 WP_000561983.1.65437 WP_000561983.1.65459 WP_000561983.1.65463 WP_000561983.1.65471 WP_000561983.1.65474 WP_000561983.1.65487 WP_000561983.1.6549 WP_000561983.1.65499 WP_000561983.1.6550 WP_000561983.1.65508 WP_000561983.1.65538 WP_000561983.1.6554 WP_000561983.1.65558 WP_000561983.1.65572 WP_000561983.1.6560 WP_000561983.1.65601 WP_000561983.1.6561 WP_000561983.1.65620 WP_000561983.1.65633 WP_000561983.1.6565 WP_000561983.1.65650 WP_000561983.1.65687 WP_000561983.1.65696 WP_000561983.1.65697 WP_000561983.1.65698 WP_000561983.1.65699 WP_000561983.1.6572 WP_000561983.1.65737 WP_000561983.1.6575 WP_000561983.1.65755 WP_000561983.1.65771 WP_000561983.1.65782 WP_000561983.1.65790 WP_000561983.1.65795 WP_000561983.1.65812 WP_000561983.1.65838 WP_000561983.1.65846 WP_000561983.1.65849 WP_000561983.1.65863 WP_000561983.1.65876 WP_000561983.1.65881 WP_000561983.1.65883 WP_000561983.1.65901 WP_000561983.1.6594 WP_000561983.1.65940 WP_000561983.1.6595 WP_000561983.1.65956 WP_000561983.1.65968 WP_000561983.1.65985 WP_000561983.1.66021 WP_000561983.1.66031 WP_000561983.1.66049 WP_000561983.1.66052 WP_000561983.1.66064 WP_000561983.1.66074 WP_000561983.1.66082 WP_000561983.1.66085 WP_000561983.1.66109 WP_000561983.1.66122 WP_000561983.1.66129 WP_000561983.1.66145 WP_000561983.1.66167 WP_000561983.1.66171 WP_000561983.1.66183 WP_000561983.1.6620 WP_000561983.1.66216 WP_000561983.1.66234 WP_000561983.1.66235 WP_000561983.1.66250 WP_000561983.1.66270 WP_000561983.1.66272 WP_000561983.1.66273 WP_000561983.1.66289 WP_000561983.1.6630 WP_000561983.1.66314 WP_000561983.1.66315 WP_000561983.1.66324 WP_000561983.1.66330 WP_000561983.1.6634 WP_000561983.1.66358 WP_000561983.1.66361 WP_000561983.1.66362 WP_000561983.1.66365 WP_000561983.1.66368 WP_000561983.1.6638 WP_000561983.1.66385 WP_000561983.1.6640 WP_000561983.1.66400 WP_000561983.1.66428 WP_000561983.1.66446 WP_000561983.1.66462 WP_000561983.1.6647 WP_000561983.1.66480 WP_000561983.1.66492 WP_000561983.1.66506 WP_000561983.1.66534 WP_000561983.1.66539 WP_000561983.1.66600 WP_000561983.1.66630 WP_000561983.1.66665 WP_000561983.1.66678 WP_000561983.1.66681 WP_000561983.1.66684 WP_000561983.1.66698 WP_000561983.1.66702 WP_000561983.1.66733 WP_000561983.1.66755 WP_000561983.1.66759 WP_000561983.1.66779 WP_000561983.1.6680 WP_000561983.1.66800 WP_000561983.1.66801 WP_000561983.1.66807 WP_000561983.1.66820 WP_000561983.1.66824 WP_000561983.1.66825 WP_000561983.1.66834 WP_000561983.1.66860 WP_000561983.1.66876 WP_000561983.1.66901 WP_000561983.1.6692 WP_000561983.1.66937 WP_000561983.1.66953 WP_000561983.1.66955 WP_000561983.1.66959 WP_000561983.1.66962 WP_000561983.1.66981 WP_000561983.1.67 WP_000561983.1.67024 WP_000561983.1.67037 WP_000561983.1.67042 WP_000561983.1.67045 WP_000561983.1.67075 WP_000561983.1.6710 WP_000561983.1.67100 WP_000561983.1.67101 WP_000561983.1.67143 WP_000561983.1.67173 WP_000561983.1.67175 WP_000561983.1.67181 WP_000561983.1.67184 WP_000561983.1.67201 WP_000561983.1.67211 WP_000561983.1.67235 WP_000561983.1.67237 WP_000561983.1.67268 WP_000561983.1.67279 WP_000561983.1.67288 WP_000561983.1.67336 WP_000561983.1.67339 WP_000561983.1.67347 WP_000561983.1.67374 WP_000561983.1.67387 WP_000561983.1.6739 WP_000561983.1.67394 WP_000561983.1.67397 WP_000561983.1.67403 WP_000561983.1.67405 WP_000561983.1.67424 WP_000561983.1.67430 WP_000561983.1.67442 WP_000561983.1.67465 WP_000561983.1.67539 WP_000561983.1.67552 WP_000561983.1.67556 WP_000561983.1.67576 WP_000561983.1.6760 WP_000561983.1.67603 WP_000561983.1.67604 WP_000561983.1.67617 WP_000561983.1.67619 WP_000561983.1.67623 WP_000561983.1.67625 WP_000561983.1.67627 WP_000561983.1.67633 WP_000561983.1.67637 WP_000561983.1.67641 WP_000561983.1.67657 WP_000561983.1.67673 WP_000561983.1.67682 WP_000561983.1.67700 WP_000561983.1.67705 WP_000561983.1.67707 WP_000561983.1.67718 WP_000561983.1.67729 WP_000561983.1.67731 WP_000561983.1.67772 WP_000561983.1.67774 WP_000561983.1.67776 WP_000561983.1.67803 WP_000561983.1.67814 WP_000561983.1.6782 WP_000561983.1.67820 WP_000561983.1.67827 WP_000561983.1.67829 WP_000561983.1.6785 WP_000561983.1.67887 WP_000561983.1.67905 WP_000561983.1.67910 WP_000561983.1.67924 WP_000561983.1.67932 WP_000561983.1.67942 WP_000561983.1.67954 WP_000561983.1.67969 WP_000561983.1.67970 WP_000561983.1.67977 WP_000561983.1.67988 WP_000561983.1.68 WP_000561983.1.68036 WP_000561983.1.68043 WP_000561983.1.68073 WP_000561983.1.68075 WP_000561983.1.6809 WP_000561983.1.68105 WP_000561983.1.68113 WP_000561983.1.68115 WP_000561983.1.68131 WP_000561983.1.68140 WP_000561983.1.68147 WP_000561983.1.68159 WP_000561983.1.68167 WP_000561983.1.68182 WP_000561983.1.6819 WP_000561983.1.68201 WP_000561983.1.68206 WP_000561983.1.68210 WP_000561983.1.6827 WP_000561983.1.68275 WP_000561983.1.68285 WP_000561983.1.6833 WP_000561983.1.68359 WP_000561983.1.68401 WP_000561983.1.68420 WP_000561983.1.68477 WP_000561983.1.68478 WP_000561983.1.6849 WP_000561983.1.685 WP_000561983.1.68514 WP_000561983.1.68532 WP_000561983.1.68547 WP_000561983.1.68564 WP_000561983.1.6857 WP_000561983.1.6858 WP_000561983.1.68589 WP_000561983.1.68591 WP_000561983.1.68629 WP_000561983.1.68652 WP_000561983.1.68655 WP_000561983.1.68656 WP_000561983.1.68658 WP_000561983.1.68677 WP_000561983.1.68688 WP_000561983.1.6869 WP_000561983.1.68690 WP_000561983.1.68742 WP_000561983.1.6875 WP_000561983.1.68770 WP_000561983.1.68778 WP_000561983.1.68787 WP_000561983.1.68809 WP_000561983.1.68816 WP_000561983.1.68818 WP_000561983.1.6882 WP_000561983.1.6883 WP_000561983.1.68893 WP_000561983.1.68894 WP_000561983.1.68895 WP_000561983.1.68914 WP_000561983.1.68928 WP_000561983.1.68958 WP_000561983.1.68966 WP_000561983.1.68975 WP_000561983.1.68999 WP_000561983.1.69001 WP_000561983.1.69006 WP_000561983.1.69011 WP_000561983.1.69029 WP_000561983.1.6904 WP_000561983.1.69042 WP_000561983.1.6905 WP_000561983.1.69053 WP_000561983.1.69058 WP_000561983.1.6907 WP_000561983.1.69080 WP_000561983.1.69086 WP_000561983.1.6913 WP_000561983.1.69131 WP_000561983.1.69139 WP_000561983.1.69146 WP_000561983.1.69151 WP_000561983.1.69170 WP_000561983.1.69210 WP_000561983.1.69236 WP_000561983.1.69255 WP_000561983.1.69270 WP_000561983.1.69273 WP_000561983.1.69282 WP_000561983.1.69288 WP_000561983.1.69296 WP_000561983.1.69320 WP_000561983.1.69346 WP_000561983.1.69357 WP_000561983.1.69359 WP_000561983.1.69371 WP_000561983.1.69376 WP_000561983.1.69385 WP_000561983.1.69396 WP_000561983.1.69397 WP_000561983.1.69465 WP_000561983.1.69466 WP_000561983.1.69485 WP_000561983.1.69515 WP_000561983.1.6954 WP_000561983.1.69554 WP_000561983.1.69564 WP_000561983.1.69575 WP_000561983.1.69588 WP_000561983.1.69592 WP_000561983.1.69597 WP_000561983.1.69611 WP_000561983.1.69616 WP_000561983.1.69636 WP_000561983.1.69642 WP_000561983.1.69644 WP_000561983.1.69656 WP_000561983.1.69657 WP_000561983.1.69690 WP_000561983.1.69696 WP_000561983.1.69704 WP_000561983.1.69710 WP_000561983.1.69754 WP_000561983.1.69758 WP_000561983.1.69760 WP_000561983.1.69767 WP_000561983.1.69785 WP_000561983.1.69787 WP_000561983.1.69790 WP_000561983.1.69807 WP_000561983.1.69808 WP_000561983.1.69817 WP_000561983.1.69848 WP_000561983.1.69890 WP_000561983.1.69923 WP_000561983.1.69948 WP_000561983.1.69953 WP_000561983.1.69965 WP_000561983.1.69975 WP_000561983.1.69977 WP_000561983.1.69982 WP_000561983.1.70003 WP_000561983.1.70010 WP_000561983.1.70028 WP_000561983.1.70047 WP_000561983.1.70049 WP_000561983.1.70058 WP_000561983.1.70061 WP_000561983.1.70087 WP_000561983.1.70088 WP_000561983.1.7010 WP_000561983.1.7014 WP_000561983.1.7016 WP_000561983.1.70169 WP_000561983.1.70183 WP_000561983.1.70205 WP_000561983.1.7021 WP_000561983.1.70240 WP_000561983.1.70241 WP_000561983.1.70248 WP_000561983.1.70249 WP_000561983.1.70261 WP_000561983.1.70269 WP_000561983.1.70272 WP_000561983.1.70281 WP_000561983.1.70289 WP_000561983.1.70290 WP_000561983.1.70303 WP_000561983.1.70314 WP_000561983.1.70321 WP_000561983.1.70326 WP_000561983.1.70327 WP_000561983.1.7033 WP_000561983.1.70355 WP_000561983.1.70394 WP_000561983.1.70427 WP_000561983.1.70433 WP_000561983.1.7044 WP_000561983.1.70440 WP_000561983.1.70447 WP_000561983.1.70485 WP_000561983.1.70488 WP_000561983.1.70491 WP_000561983.1.70523 WP_000561983.1.70531 WP_000561983.1.70545 WP_000561983.1.70547 WP_000561983.1.7055 WP_000561983.1.70580 WP_000561983.1.70596 WP_000561983.1.70623 WP_000561983.1.70643 WP_000561983.1.70644 WP_000561983.1.70671 WP_000561983.1.70678 WP_000561983.1.70679 WP_000561983.1.70683 WP_000561983.1.70685 WP_000561983.1.70708 WP_000561983.1.70712 WP_000561983.1.70717 WP_000561983.1.70731 WP_000561983.1.70732 WP_000561983.1.70733 WP_000561983.1.70761 WP_000561983.1.70772 WP_000561983.1.70785 WP_000561983.1.70792 WP_000561983.1.70797 WP_000561983.1.70837 WP_000561983.1.70845 WP_000561983.1.70846 WP_000561983.1.70869 WP_000561983.1.70883 WP_000561983.1.70899 WP_000561983.1.70914 WP_000561983.1.70922 WP_000561983.1.70929 WP_000561983.1.7093 WP_000561983.1.70948 WP_000561983.1.70959 WP_000561983.1.70969 WP_000561983.1.70971 WP_000561983.1.70977 WP_000561983.1.70981 WP_000561983.1.70985 WP_000561983.1.70986 WP_000561983.1.70995 WP_000561983.1.71007 WP_000561983.1.71010 WP_000561983.1.71023 WP_000561983.1.71039 WP_000561983.1.71057 WP_000561983.1.71069 WP_000561983.1.71081 WP_000561983.1.71088 WP_000561983.1.7110 WP_000561983.1.71116 WP_000561983.1.71117 WP_000561983.1.71120 WP_000561983.1.71146 WP_000561983.1.71150 WP_000561983.1.71165 WP_000561983.1.71171 WP_000561983.1.71172 WP_000561983.1.71184 WP_000561983.1.71186 WP_000561983.1.71188 WP_000561983.1.71201 WP_000561983.1.71202 WP_000561983.1.71243 WP_000561983.1.71245 WP_000561983.1.71248 WP_000561983.1.71268 WP_000561983.1.71299 WP_000561983.1.71305 WP_000561983.1.71306 WP_000561983.1.71337 WP_000561983.1.7134 WP_000561983.1.71363 WP_000561983.1.71368 WP_000561983.1.71378 WP_000561983.1.714 WP_000561983.1.71401 WP_000561983.1.71407 WP_000561983.1.7142 WP_000561983.1.71446 WP_000561983.1.71450 WP_000561983.1.71452 WP_000561983.1.71455 WP_000561983.1.71456 WP_000561983.1.71481 WP_000561983.1.71487 WP_000561983.1.71500 WP_000561983.1.71523 WP_000561983.1.71542 WP_000561983.1.71566 WP_000561983.1.71583 WP_000561983.1.71600 WP_000561983.1.71626 WP_000561983.1.71636 WP_000561983.1.71640 WP_000561983.1.71649 WP_000561983.1.71651 WP_000561983.1.71653 WP_000561983.1.71658 WP_000561983.1.71667 WP_000561983.1.71691 WP_000561983.1.71702 WP_000561983.1.71716 WP_000561983.1.7174 WP_000561983.1.71746 WP_000561983.1.71750 WP_000561983.1.71756 WP_000561983.1.71793 WP_000561983.1.71798 WP_000561983.1.71845 WP_000561983.1.71872 WP_000561983.1.71881 WP_000561983.1.71908 WP_000561983.1.71923 WP_000561983.1.71929 WP_000561983.1.71941 WP_000561983.1.71950 WP_000561983.1.71952 WP_000561983.1.71954 WP_000561983.1.71973 WP_000561983.1.71979 WP_000561983.1.71984 WP_000561983.1.71985 WP_000561983.1.720 WP_000561983.1.72003 WP_000561983.1.72065 WP_000561983.1.72068 WP_000561983.1.72073 WP_000561983.1.72100 WP_000561983.1.72105 WP_000561983.1.72107 WP_000561983.1.72119 WP_000561983.1.72182 WP_000561983.1.72188 WP_000561983.1.72190 WP_000561983.1.72203 WP_000561983.1.72220 WP_000561983.1.72221 WP_000561983.1.72226 WP_000561983.1.72234 WP_000561983.1.72243 WP_000561983.1.72269 WP_000561983.1.72277 WP_000561983.1.72281 WP_000561983.1.72283 WP_000561983.1.72300 WP_000561983.1.72307 WP_000561983.1.72325 WP_000561983.1.72339 WP_000561983.1.72350 WP_000561983.1.72351 WP_000561983.1.72372 WP_000561983.1.72376 WP_000561983.1.72382 WP_000561983.1.72383 WP_000561983.1.72399 WP_000561983.1.72403 WP_000561983.1.72412 WP_000561983.1.7243 WP_000561983.1.72438 WP_000561983.1.72461 WP_000561983.1.72470 WP_000561983.1.72527 WP_000561983.1.72532 WP_000561983.1.7255 WP_000561983.1.72594 WP_000561983.1.72602 WP_000561983.1.72625 WP_000561983.1.72629 WP_000561983.1.72631 WP_000561983.1.72638 WP_000561983.1.72642 WP_000561983.1.72667 WP_000561983.1.72671 WP_000561983.1.72674 WP_000561983.1.72689 WP_000561983.1.72716 WP_000561983.1.72718 WP_000561983.1.72724 WP_000561983.1.72728 WP_000561983.1.72789 WP_000561983.1.72793 WP_000561983.1.72827 WP_000561983.1.72828 WP_000561983.1.72843 WP_000561983.1.72850 WP_000561983.1.72865 WP_000561983.1.72871 WP_000561983.1.72872 WP_000561983.1.72887 WP_000561983.1.72892 WP_000561983.1.72894 WP_000561983.1.72896 WP_000561983.1.72897 WP_000561983.1.72944 WP_000561983.1.7295 WP_000561983.1.72968 WP_000561983.1.72969 WP_000561983.1.72975 WP_000561983.1.72987 WP_000561983.1.7304 WP_000561983.1.73052 WP_000561983.1.73062 WP_000561983.1.73068 WP_000561983.1.7311 WP_000561983.1.73114 WP_000561983.1.73125 WP_000561983.1.73144 WP_000561983.1.7315 WP_000561983.1.7316 WP_000561983.1.73164 WP_000561983.1.73177 WP_000561983.1.73180 WP_000561983.1.73200 WP_000561983.1.73258 WP_000561983.1.73270 WP_000561983.1.73285 WP_000561983.1.7332 WP_000561983.1.73328 WP_000561983.1.7333 WP_000561983.1.73338 WP_000561983.1.7334 WP_000561983.1.73352 WP_000561983.1.73362 WP_000561983.1.73377 WP_000561983.1.73379 WP_000561983.1.73389 WP_000561983.1.7341 WP_000561983.1.73425 WP_000561983.1.73461 WP_000561983.1.73481 WP_000561983.1.73488 WP_000561983.1.73504 WP_000561983.1.73512 WP_000561983.1.7353 WP_000561983.1.73535 WP_000561983.1.73544 WP_000561983.1.7356 WP_000561983.1.73561 WP_000561983.1.73581 WP_000561983.1.73596 WP_000561983.1.73598 WP_000561983.1.7361 WP_000561983.1.73617 WP_000561983.1.73648 WP_000561983.1.73667 WP_000561983.1.73669 WP_000561983.1.73701 WP_000561983.1.73708 WP_000561983.1.7374 WP_000561983.1.73753 WP_000561983.1.73758 WP_000561983.1.73764 WP_000561983.1.73768 WP_000561983.1.73794 WP_000561983.1.73804 WP_000561983.1.73831 WP_000561983.1.73847 WP_000561983.1.73849 WP_000561983.1.7386 WP_000561983.1.7387 WP_000561983.1.73901 WP_000561983.1.73924 WP_000561983.1.73926 WP_000561983.1.7394 WP_000561983.1.73945 WP_000561983.1.73948 WP_000561983.1.73956 WP_000561983.1.73965 WP_000561983.1.73999 WP_000561983.1.74024 WP_000561983.1.74028 WP_000561983.1.74029 WP_000561983.1.74030 WP_000561983.1.74038 WP_000561983.1.74040 WP_000561983.1.74043 WP_000561983.1.74049 WP_000561983.1.7405 WP_000561983.1.74058 WP_000561983.1.74070 WP_000561983.1.74077 WP_000561983.1.74089 WP_000561983.1.74117 WP_000561983.1.74135 WP_000561983.1.74163 WP_000561983.1.74174 WP_000561983.1.74181 WP_000561983.1.74191 WP_000561983.1.74207 WP_000561983.1.74214 WP_000561983.1.74228 WP_000561983.1.74241 WP_000561983.1.74248 WP_000561983.1.74285 WP_000561983.1.743 WP_000561983.1.7430 WP_000561983.1.74300 WP_000561983.1.74317 WP_000561983.1.7433 WP_000561983.1.74379 WP_000561983.1.74402 WP_000561983.1.74410 WP_000561983.1.74414 WP_000561983.1.74415 WP_000561983.1.74418 WP_000561983.1.74422 WP_000561983.1.74428 WP_000561983.1.7444 WP_000561983.1.74454 WP_000561983.1.74466 WP_000561983.1.74469 WP_000561983.1.74481 WP_000561983.1.745 WP_000561983.1.74500 WP_000561983.1.74529 WP_000561983.1.74545 WP_000561983.1.74570 WP_000561983.1.74578 WP_000561983.1.74616 WP_000561983.1.74620 WP_000561983.1.74621 WP_000561983.1.74632 WP_000561983.1.74639 WP_000561983.1.74644 WP_000561983.1.74647 WP_000561983.1.74661 WP_000561983.1.74677 WP_000561983.1.74699 WP_000561983.1.74702 WP_000561983.1.74745 WP_000561983.1.74757 WP_000561983.1.74806 WP_000561983.1.74807 WP_000561983.1.74826 WP_000561983.1.74831 WP_000561983.1.74876 WP_000561983.1.74884 WP_000561983.1.74894 WP_000561983.1.7491 WP_000561983.1.74929 WP_000561983.1.74939 WP_000561983.1.74946 WP_000561983.1.74972 WP_000561983.1.74973 WP_000561983.1.74992 WP_000561983.1.74996 WP_000561983.1.75009 WP_000561983.1.75051 WP_000561983.1.75056 WP_000561983.1.75058 WP_000561983.1.7507 WP_000561983.1.75089 WP_000561983.1.75114 WP_000561983.1.75116 WP_000561983.1.75129 WP_000561983.1.75134 WP_000561983.1.75148 WP_000561983.1.75159 WP_000561983.1.75168 WP_000561983.1.75177 WP_000561983.1.75180 WP_000561983.1.75187 WP_000561983.1.75237 WP_000561983.1.75273 WP_000561983.1.75288 WP_000561983.1.75296 WP_000561983.1.75301 WP_000561983.1.7531 WP_000561983.1.75334 WP_000561983.1.75362 WP_000561983.1.75385 WP_000561983.1.75392 WP_000561983.1.75400 WP_000561983.1.75402 WP_000561983.1.75413 WP_000561983.1.7543 WP_000561983.1.75433 WP_000561983.1.75450 WP_000561983.1.75494 WP_000561983.1.75532 WP_000561983.1.75565 WP_000561983.1.7558 WP_000561983.1.75585 WP_000561983.1.75593 WP_000561983.1.75607 WP_000561983.1.75609 WP_000561983.1.75610 WP_000561983.1.75626 WP_000561983.1.7563 WP_000561983.1.75633 WP_000561983.1.75664 WP_000561983.1.75703 WP_000561983.1.75716 WP_000561983.1.75718 WP_000561983.1.75740 WP_000561983.1.75745 WP_000561983.1.75751 WP_000561983.1.75760 WP_000561983.1.75764 WP_000561983.1.75793 WP_000561983.1.75794 WP_000561983.1.75810 WP_000561983.1.75828 WP_000561983.1.75835 WP_000561983.1.75837 WP_000561983.1.75844 WP_000561983.1.75863 WP_000561983.1.75873 WP_000561983.1.75874 WP_000561983.1.75884 WP_000561983.1.75886 WP_000561983.1.75898 WP_000561983.1.75902 WP_000561983.1.75919 WP_000561983.1.75932 WP_000561983.1.75945 WP_000561983.1.75957 WP_000561983.1.75997 WP_000561983.1.76 WP_000561983.1.76020 WP_000561983.1.76024 WP_000561983.1.76055 WP_000561983.1.76081 WP_000561983.1.76097 WP_000561983.1.76102 WP_000561983.1.76108 WP_000561983.1.76116 WP_000561983.1.76122 WP_000561983.1.76137 WP_000561983.1.76156 WP_000561983.1.76164 WP_000561983.1.76170 WP_000561983.1.76186 WP_000561983.1.76208 WP_000561983.1.76252 WP_000561983.1.76256 WP_000561983.1.7629 WP_000561983.1.76301 WP_000561983.1.76327 WP_000561983.1.7633 WP_000561983.1.76339 WP_000561983.1.7634 WP_000561983.1.76345 WP_000561983.1.76346 WP_000561983.1.76364 WP_000561983.1.76366 WP_000561983.1.76417 WP_000561983.1.76434 WP_000561983.1.76445 WP_000561983.1.76451 WP_000561983.1.7646 WP_000561983.1.76471 WP_000561983.1.76495 WP_000561983.1.76510 WP_000561983.1.76516 WP_000561983.1.76529 WP_000561983.1.76532 WP_000561983.1.76548 WP_000561983.1.7655 WP_000561983.1.76558 WP_000561983.1.7657 WP_000561983.1.76572 WP_000561983.1.76576 WP_000561983.1.7660 WP_000561983.1.76611 WP_000561983.1.76641 WP_000561983.1.76651 WP_000561983.1.76653 WP_000561983.1.76673 WP_000561983.1.76706 WP_000561983.1.7672 WP_000561983.1.76721 WP_000561983.1.76724 WP_000561983.1.76738 WP_000561983.1.76756 WP_000561983.1.76760 WP_000561983.1.76776 WP_000561983.1.76788 WP_000561983.1.76799 WP_000561983.1.76806 WP_000561983.1.7684 WP_000561983.1.76854 WP_000561983.1.76866 WP_000561983.1.76875 WP_000561983.1.76880 WP_000561983.1.76899 WP_000561983.1.76913 WP_000561983.1.76916 WP_000561983.1.76932 WP_000561983.1.76968 WP_000561983.1.76973 WP_000561983.1.76988 WP_000561983.1.77016 WP_000561983.1.77017 WP_000561983.1.77033 WP_000561983.1.77038 WP_000561983.1.77047 WP_000561983.1.77067 WP_000561983.1.77080 WP_000561983.1.77087 WP_000561983.1.77090 WP_000561983.1.77111 WP_000561983.1.7712 WP_000561983.1.77177 WP_000561983.1.77180 WP_000561983.1.77184 WP_000561983.1.77193 WP_000561983.1.77244 WP_000561983.1.77267 WP_000561983.1.77271 WP_000561983.1.77292 WP_000561983.1.77299 WP_000561983.1.77306 WP_000561983.1.77313 WP_000561983.1.77349 WP_000561983.1.77356 WP_000561983.1.77384 WP_000561983.1.77390 WP_000561983.1.77414 WP_000561983.1.77431 WP_000561983.1.77436 WP_000561983.1.77440 WP_000561983.1.77475 WP_000561983.1.77496 WP_000561983.1.77501 WP_000561983.1.77512 WP_000561983.1.77513 WP_000561983.1.77514 WP_000561983.1.77529 WP_000561983.1.77543 WP_000561983.1.77549 WP_000561983.1.77555 WP_000561983.1.77563 WP_000561983.1.77565 WP_000561983.1.77575 WP_000561983.1.77596 WP_000561983.1.77622 WP_000561983.1.77629 WP_000561983.1.77646 WP_000561983.1.77653 WP_000561983.1.77692 WP_000561983.1.77702 WP_000561983.1.77710 WP_000561983.1.77713 WP_000561983.1.7772 WP_000561983.1.77729 WP_000561983.1.77754 WP_000561983.1.77761 WP_000561983.1.7782 WP_000561983.1.77825 WP_000561983.1.77837 WP_000561983.1.77846 WP_000561983.1.77851 WP_000561983.1.77871 WP_000561983.1.77898 WP_000561983.1.77900 WP_000561983.1.77918 WP_000561983.1.7792 WP_000561983.1.77923 WP_000561983.1.7793 WP_000561983.1.77951 WP_000561983.1.77960 WP_000561983.1.77971 WP_000561983.1.77975 WP_000561983.1.77983 WP_000561983.1.77989 WP_000561983.1.78 WP_000561983.1.78016 WP_000561983.1.7802 WP_000561983.1.78026 WP_000561983.1.78033 WP_000561983.1.78035 WP_000561983.1.78048 WP_000561983.1.78051 WP_000561983.1.78053 WP_000561983.1.78076 WP_000561983.1.78096 WP_000561983.1.78100 WP_000561983.1.78107 WP_000561983.1.78110 WP_000561983.1.78120 WP_000561983.1.7814 WP_000561983.1.78166 WP_000561983.1.78168 WP_000561983.1.78170 WP_000561983.1.78180 WP_000561983.1.78192 WP_000561983.1.78195 WP_000561983.1.78201 WP_000561983.1.78245 WP_000561983.1.78259 WP_000561983.1.78291 WP_000561983.1.78301 WP_000561983.1.78309 WP_000561983.1.78320 WP_000561983.1.78339 WP_000561983.1.78366 WP_000561983.1.78372 WP_000561983.1.78382 WP_000561983.1.78383 WP_000561983.1.78388 WP_000561983.1.78407 WP_000561983.1.78410 WP_000561983.1.78426 WP_000561983.1.78443 WP_000561983.1.78495 WP_000561983.1.78496 WP_000561983.1.78501 WP_000561983.1.78502 WP_000561983.1.78568 WP_000561983.1.78602 WP_000561983.1.78603 WP_000561983.1.7861 WP_000561983.1.78618 WP_000561983.1.7862 WP_000561983.1.78626 WP_000561983.1.78632 WP_000561983.1.78658 WP_000561983.1.78661 WP_000561983.1.78673 WP_000561983.1.78674 WP_000561983.1.78676 WP_000561983.1.78697 WP_000561983.1.78715 WP_000561983.1.78734 WP_000561983.1.78735 WP_000561983.1.78738 WP_000561983.1.78761 WP_000561983.1.7877 WP_000561983.1.78771 WP_000561983.1.78789 WP_000561983.1.78802 WP_000561983.1.78815 WP_000561983.1.78830 WP_000561983.1.78835 WP_000561983.1.78838 WP_000561983.1.78862 WP_000561983.1.78871 WP_000561983.1.78874 WP_000561983.1.78877 WP_000561983.1.78881 WP_000561983.1.78896 WP_000561983.1.789 WP_000561983.1.7891 WP_000561983.1.78913 WP_000561983.1.78918 WP_000561983.1.78928 WP_000561983.1.7893 WP_000561983.1.78930 WP_000561983.1.78951 WP_000561983.1.78993 WP_000561983.1.79011 WP_000561983.1.79012 WP_000561983.1.79032 WP_000561983.1.79069 WP_000561983.1.79074 WP_000561983.1.79081 WP_000561983.1.79098 WP_000561983.1.79099 WP_000561983.1.79140 WP_000561983.1.79151 WP_000561983.1.79155 WP_000561983.1.79164 WP_000561983.1.79167 WP_000561983.1.79189 WP_000561983.1.79203 WP_000561983.1.79204 WP_000561983.1.79235 WP_000561983.1.79280 WP_000561983.1.79289 WP_000561983.1.79297 WP_000561983.1.79302 WP_000561983.1.79335 WP_000561983.1.79370 WP_000561983.1.79397 WP_000561983.1.794 WP_000561983.1.79427 WP_000561983.1.79456 WP_000561983.1.79462 WP_000561983.1.79466 WP_000561983.1.79468 WP_000561983.1.79472 WP_000561983.1.79490 WP_000561983.1.79495 WP_000561983.1.79529 WP_000561983.1.79532 WP_000561983.1.79547 WP_000561983.1.7956 WP_000561983.1.79570 WP_000561983.1.79580 WP_000561983.1.79586 WP_000561983.1.79635 WP_000561983.1.7964 WP_000561983.1.79642 WP_000561983.1.79645 WP_000561983.1.79654 WP_000561983.1.79659 WP_000561983.1.79668 WP_000561983.1.7970 WP_000561983.1.79708 WP_000561983.1.7972 WP_000561983.1.79722 WP_000561983.1.79734 WP_000561983.1.79738 WP_000561983.1.79757 WP_000561983.1.79772 WP_000561983.1.79778 WP_000561983.1.7979 WP_000561983.1.7982 WP_000561983.1.79832 WP_000561983.1.79842 WP_000561983.1.79845 WP_000561983.1.79867 WP_000561983.1.79880 WP_000561983.1.79892 WP_000561983.1.7991 WP_000561983.1.79910 WP_000561983.1.79914 WP_000561983.1.79916 WP_000561983.1.79929 WP_000561983.1.79934 WP_000561983.1.7994 WP_000561983.1.79942 WP_000561983.1.79945 WP_000561983.1.79951 WP_000561983.1.79966 WP_000561983.1.79974 WP_000561983.1.79996 WP_000561983.1.80065 WP_000561983.1.80077 WP_000561983.1.80103 WP_000561983.1.80137 WP_000561983.1.80149 WP_000561983.1.80157 WP_000561983.1.80182 WP_000561983.1.80229 WP_000561983.1.80236 WP_000561983.1.8024 WP_000561983.1.80249 WP_000561983.1.80250 WP_000561983.1.80254 WP_000561983.1.80273 WP_000561983.1.80282 WP_000561983.1.80293 WP_000561983.1.80296 WP_000561983.1.80307 WP_000561983.1.80333 WP_000561983.1.80354 WP_000561983.1.80366 WP_000561983.1.80368 WP_000561983.1.80380 WP_000561983.1.80386 WP_000561983.1.80400 WP_000561983.1.80441 WP_000561983.1.80443 WP_000561983.1.80448 WP_000561983.1.80462 WP_000561983.1.80473 WP_000561983.1.80479 WP_000561983.1.80480 WP_000561983.1.8049 WP_000561983.1.80492 WP_000561983.1.80496 WP_000561983.1.80529 WP_000561983.1.80542 WP_000561983.1.80569 WP_000561983.1.80586 WP_000561983.1.80609 WP_000561983.1.80629 WP_000561983.1.80638 WP_000561983.1.80651 WP_000561983.1.80664 WP_000561983.1.80667 WP_000561983.1.80674 WP_000561983.1.80696 WP_000561983.1.80705 WP_000561983.1.80707 WP_000561983.1.80723 WP_000561983.1.80725 WP_000561983.1.80741 WP_000561983.1.80750 WP_000561983.1.80757 WP_000561983.1.80760 WP_000561983.1.80780 WP_000561983.1.80803 WP_000561983.1.80819 WP_000561983.1.80827 WP_000561983.1.80831 WP_000561983.1.80840 WP_000561983.1.80850 WP_000561983.1.80857 WP_000561983.1.80868 WP_000561983.1.80874 WP_000561983.1.80876 WP_000561983.1.80881 WP_000561983.1.80913 WP_000561983.1.80927 WP_000561983.1.80941 WP_000561983.1.80959 WP_000561983.1.8096 WP_000561983.1.80973 WP_000561983.1.80984 WP_000561983.1.81037 WP_000561983.1.8106 WP_000561983.1.81062 WP_000561983.1.81067 WP_000561983.1.81069 WP_000561983.1.81107 WP_000561983.1.81109 WP_000561983.1.81110 WP_000561983.1.81118 WP_000561983.1.81131 WP_000561983.1.81149 WP_000561983.1.81175 WP_000561983.1.81187 WP_000561983.1.8119 WP_000561983.1.81193 WP_000561983.1.81197 WP_000561983.1.81225 WP_000561983.1.81231 WP_000561983.1.81262 WP_000561983.1.81268 WP_000561983.1.81269 WP_000561983.1.8127 WP_000561983.1.81271 WP_000561983.1.81275 WP_000561983.1.8130 WP_000561983.1.81302 WP_000561983.1.81305 WP_000561983.1.8131 WP_000561983.1.81320 WP_000561983.1.81321 WP_000561983.1.81328 WP_000561983.1.81333 WP_000561983.1.8134 WP_000561983.1.81342 WP_000561983.1.81354 WP_000561983.1.81364 WP_000561983.1.81388 WP_000561983.1.81404 WP_000561983.1.81409 WP_000561983.1.81410 WP_000561983.1.81425 WP_000561983.1.81455 WP_000561983.1.81472 WP_000561983.1.81494 WP_000561983.1.81504 WP_000561983.1.81528 WP_000561983.1.81548 WP_000561983.1.81557 WP_000561983.1.81635 WP_000561983.1.81667 WP_000561983.1.81668 WP_000561983.1.81676 WP_000561983.1.8168 WP_000561983.1.81681 WP_000561983.1.8170 WP_000561983.1.81727 WP_000561983.1.81735 WP_000561983.1.81736 WP_000561983.1.81743 WP_000561983.1.81746 WP_000561983.1.81750 WP_000561983.1.81760 WP_000561983.1.81763 WP_000561983.1.81768 WP_000561983.1.81785 WP_000561983.1.81795 WP_000561983.1.81855 WP_000561983.1.81902 WP_000561983.1.81921 WP_000561983.1.81931 WP_000561983.1.81936 WP_000561983.1.81941 WP_000561983.1.81949 WP_000561983.1.8196 WP_000561983.1.81965 WP_000561983.1.81974 WP_000561983.1.81977 WP_000561983.1.81995 WP_000561983.1.82037 WP_000561983.1.82070 WP_000561983.1.82076 WP_000561983.1.82099 WP_000561983.1.82131 WP_000561983.1.82132 WP_000561983.1.82141 WP_000561983.1.82144 WP_000561983.1.82149 WP_000561983.1.82156 WP_000561983.1.8218 WP_000561983.1.82180 WP_000561983.1.82192 WP_000561983.1.82201 WP_000561983.1.82214 WP_000561983.1.82225 WP_000561983.1.82232 WP_000561983.1.82258 WP_000561983.1.82269 WP_000561983.1.82337 WP_000561983.1.82347 WP_000561983.1.82352 WP_000561983.1.8236 WP_000561983.1.82369 WP_000561983.1.82395 WP_000561983.1.8240 WP_000561983.1.82401 WP_000561983.1.82408 WP_000561983.1.82416 WP_000561983.1.8242 WP_000561983.1.82420 WP_000561983.1.82434 WP_000561983.1.82456 WP_000561983.1.82464 WP_000561983.1.82465 WP_000561983.1.8247 WP_000561983.1.82473 WP_000561983.1.82474 WP_000561983.1.82479 WP_000561983.1.82503 WP_000561983.1.82515 WP_000561983.1.82529 WP_000561983.1.82530 WP_000561983.1.82553 WP_000561983.1.82562 WP_000561983.1.82569 WP_000561983.1.82570 WP_000561983.1.82584 WP_000561983.1.82636 WP_000561983.1.82637 WP_000561983.1.82646 WP_000561983.1.82648 WP_000561983.1.82670 WP_000561983.1.82676 WP_000561983.1.82731 WP_000561983.1.82761 WP_000561983.1.82763 WP_000561983.1.82812 WP_000561983.1.8282 WP_000561983.1.82841 WP_000561983.1.82843 WP_000561983.1.82850 WP_000561983.1.82865 WP_000561983.1.82867 WP_000561983.1.82872 WP_000561983.1.82886 WP_000561983.1.82895 WP_000561983.1.82899 WP_000561983.1.82908 WP_000561983.1.82937 WP_000561983.1.8294 WP_000561983.1.82944 WP_000561983.1.82946 WP_000561983.1.82956 WP_000561983.1.82959 WP_000561983.1.82964 WP_000561983.1.82992 WP_000561983.1.83005 WP_000561983.1.83006 WP_000561983.1.83007 WP_000561983.1.8304 WP_000561983.1.83061 WP_000561983.1.83092 WP_000561983.1.83119 WP_000561983.1.83128 WP_000561983.1.83139 WP_000561983.1.83163 WP_000561983.1.83180 WP_000561983.1.83204 WP_000561983.1.8322 WP_000561983.1.83221 WP_000561983.1.83229 WP_000561983.1.83235 WP_000561983.1.83247 WP_000561983.1.83252 WP_000561983.1.83258 WP_000561983.1.83290 WP_000561983.1.83301 WP_000561983.1.83305 WP_000561983.1.83331 WP_000561983.1.83333 WP_000561983.1.83354 WP_000561983.1.83356 WP_000561983.1.83360 WP_000561983.1.83365 WP_000561983.1.83378 WP_000561983.1.83382 WP_000561983.1.83388 WP_000561983.1.83407 WP_000561983.1.83413 WP_000561983.1.83491 WP_000561983.1.83510 WP_000561983.1.83516 WP_000561983.1.83523 WP_000561983.1.8354 WP_000561983.1.83558 WP_000561983.1.83572 WP_000561983.1.83598 WP_000561983.1.83632 WP_000561983.1.83650 WP_000561983.1.83651 WP_000561983.1.83657 WP_000561983.1.83677 WP_000561983.1.83710 WP_000561983.1.83721 WP_000561983.1.83739 WP_000561983.1.8375 WP_000561983.1.83759 WP_000561983.1.83760 WP_000561983.1.83838 WP_000561983.1.83854 WP_000561983.1.83897 WP_000561983.1.83923 WP_000561983.1.83960 WP_000561983.1.83979 WP_000561983.1.8399 WP_000561983.1.83994 WP_000561983.1.83995 WP_000561983.1.84 WP_000561983.1.84000 WP_000561983.1.84001 WP_000561983.1.84011 WP_000561983.1.84031 WP_000561983.1.8406 WP_000561983.1.84075 WP_000561983.1.84076 WP_000561983.1.84077 WP_000561983.1.84083 WP_000561983.1.84086 WP_000561983.1.84100 WP_000561983.1.84103 WP_000561983.1.84106 WP_000561983.1.84110 WP_000561983.1.84115 WP_000561983.1.84127 WP_000561983.1.84150 WP_000561983.1.84154 WP_000561983.1.84168 WP_000561983.1.84179 WP_000561983.1.84198 WP_000561983.1.84205 WP_000561983.1.84209 WP_000561983.1.84229 WP_000561983.1.84230 WP_000561983.1.8425 WP_000561983.1.84252 WP_000561983.1.84283 WP_000561983.1.84291 WP_000561983.1.84300 WP_000561983.1.8431 WP_000561983.1.84325 WP_000561983.1.84345 WP_000561983.1.84355 WP_000561983.1.84359 WP_000561983.1.84369 WP_000561983.1.84373 WP_000561983.1.84392 WP_000561983.1.84397 WP_000561983.1.84401 WP_000561983.1.84403 WP_000561983.1.8441 WP_000561983.1.84435 WP_000561983.1.84459 WP_000561983.1.84461 WP_000561983.1.84475 WP_000561983.1.84497 WP_000561983.1.84515 WP_000561983.1.84523 WP_000561983.1.84532 WP_000561983.1.84551 WP_000561983.1.84554 WP_000561983.1.84567 WP_000561983.1.84572 WP_000561983.1.84598 WP_000561983.1.84631 WP_000561983.1.84644 WP_000561983.1.84659 WP_000561983.1.84683 WP_000561983.1.84693 WP_000561983.1.84711 WP_000561983.1.84721 WP_000561983.1.84727 WP_000561983.1.84744 WP_000561983.1.84745 WP_000561983.1.84773 WP_000561983.1.84860 WP_000561983.1.84876 WP_000561983.1.84885 WP_000561983.1.84899 WP_000561983.1.849 WP_000561983.1.84945 WP_000561983.1.84967 WP_000561983.1.8497 WP_000561983.1.84983 WP_000561983.1.850 WP_000561983.1.85004 WP_000561983.1.85014 WP_000561983.1.8502 WP_000561983.1.85031 WP_000561983.1.85039 WP_000561983.1.85040 WP_000561983.1.85079 WP_000561983.1.85094 WP_000561983.1.85120 WP_000561983.1.85126 WP_000561983.1.85134 WP_000561983.1.85147 WP_000561983.1.85153 WP_000561983.1.85178 WP_000561983.1.85180 WP_000561983.1.85190 WP_000561983.1.85192 WP_000561983.1.85217 WP_000561983.1.8526 WP_000561983.1.85271 WP_000561983.1.85273 WP_000561983.1.85301 WP_000561983.1.8533 WP_000561983.1.85338 WP_000561983.1.85339 WP_000561983.1.8537 WP_000561983.1.85408 WP_000561983.1.85433 WP_000561983.1.8545 WP_000561983.1.85456 WP_000561983.1.85469 WP_000561983.1.85481 WP_000561983.1.85483 WP_000561983.1.85511 WP_000561983.1.85512 WP_000561983.1.8552 WP_000561983.1.85541 WP_000561983.1.8556 WP_000561983.1.85568 WP_000561983.1.8557 WP_000561983.1.85606 WP_000561983.1.85615 WP_000561983.1.85617 WP_000561983.1.85635 WP_000561983.1.85646 WP_000561983.1.85654 WP_000561983.1.85663 WP_000561983.1.85665 WP_000561983.1.85669 WP_000561983.1.85671 WP_000561983.1.85672 WP_000561983.1.85675 WP_000561983.1.85688 WP_000561983.1.85703 WP_000561983.1.85723 WP_000561983.1.85728 WP_000561983.1.85742 WP_000561983.1.85746 WP_000561983.1.85759 WP_000561983.1.85777 WP_000561983.1.85780 WP_000561983.1.85784 WP_000561983.1.85791 WP_000561983.1.85797 WP_000561983.1.85811 WP_000561983.1.85854 WP_000561983.1.85855 WP_000561983.1.85864 WP_000561983.1.85886 WP_000561983.1.859 WP_000561983.1.85900 WP_000561983.1.85904 WP_000561983.1.8591 WP_000561983.1.85917 WP_000561983.1.8594 WP_000561983.1.85943 WP_000561983.1.85976 WP_000561983.1.85977 WP_000561983.1.85982 WP_000561983.1.860 WP_000561983.1.86007 WP_000561983.1.86010 WP_000561983.1.86017 WP_000561983.1.86043 WP_000561983.1.8605 WP_000561983.1.86084 WP_000561983.1.86092 WP_000561983.1.8610 WP_000561983.1.86120 WP_000561983.1.86126 WP_000561983.1.86138 WP_000561983.1.8614 WP_000561983.1.86156 WP_000561983.1.86157 WP_000561983.1.86159 WP_000561983.1.8616 WP_000561983.1.86173 WP_000561983.1.86206 WP_000561983.1.86224 WP_000561983.1.86240 WP_000561983.1.86259 WP_000561983.1.86284 WP_000561983.1.86285 WP_000561983.1.86306 WP_000561983.1.86310 WP_000561983.1.86316 WP_000561983.1.86323 WP_000561983.1.86335 WP_000561983.1.86342 WP_000561983.1.86347 WP_000561983.1.86356 WP_000561983.1.86380 WP_000561983.1.86389 WP_000561983.1.8640 WP_000561983.1.8642 WP_000561983.1.86426 WP_000561983.1.86442 WP_000561983.1.86450 WP_000561983.1.86453 WP_000561983.1.86469 WP_000561983.1.8647 WP_000561983.1.86489 WP_000561983.1.86514 WP_000561983.1.86530 WP_000561983.1.86580 WP_000561983.1.86588 WP_000561983.1.86593 WP_000561983.1.86601 WP_000561983.1.86610 WP_000561983.1.86634 WP_000561983.1.86656 WP_000561983.1.86658 WP_000561983.1.86661 WP_000561983.1.86663 WP_000561983.1.86676 WP_000561983.1.86699 WP_000561983.1.8671 WP_000561983.1.8672 WP_000561983.1.86735 WP_000561983.1.86744 WP_000561983.1.86769 WP_000561983.1.86770 WP_000561983.1.8678 WP_000561983.1.86794 WP_000561983.1.86800 WP_000561983.1.86807 WP_000561983.1.86810 WP_000561983.1.86811 WP_000561983.1.86815 WP_000561983.1.8684 WP_000561983.1.86859 WP_000561983.1.86860 WP_000561983.1.86895 WP_000561983.1.86902 WP_000561983.1.86906 WP_000561983.1.8691 WP_000561983.1.86915 WP_000561983.1.86921 WP_000561983.1.86945 WP_000561983.1.86982 WP_000561983.1.86989 WP_000561983.1.87023 WP_000561983.1.87034 WP_000561983.1.87038 WP_000561983.1.87041 WP_000561983.1.87051 WP_000561983.1.87095 WP_000561983.1.87136 WP_000561983.1.87143 WP_000561983.1.87148 WP_000561983.1.87155 WP_000561983.1.87187 WP_000561983.1.87219 WP_000561983.1.8722 WP_000561983.1.87258 WP_000561983.1.87265 WP_000561983.1.87282 WP_000561983.1.87283 WP_000561983.1.87293 WP_000561983.1.87323 WP_000561983.1.87346 WP_000561983.1.8736 WP_000561983.1.87365 WP_000561983.1.87370 WP_000561983.1.87420 WP_000561983.1.87460 WP_000561983.1.87484 WP_000561983.1.87493 WP_000561983.1.87500 WP_000561983.1.87528 WP_000561983.1.87552 WP_000561983.1.87560 WP_000561983.1.87583 WP_000561983.1.87584 WP_000561983.1.8760 WP_000561983.1.87600 WP_000561983.1.87609 WP_000561983.1.87612 WP_000561983.1.87615 WP_000561983.1.87618 WP_000561983.1.87626 WP_000561983.1.87653 WP_000561983.1.87659 WP_000561983.1.8767 WP_000561983.1.87687 WP_000561983.1.87695 WP_000561983.1.87698 WP_000561983.1.87706 WP_000561983.1.87712 WP_000561983.1.87739 WP_000561983.1.87741 WP_000561983.1.87742 WP_000561983.1.87760 WP_000561983.1.87779 WP_000561983.1.87813 WP_000561983.1.87852 WP_000561983.1.87875 WP_000561983.1.87899 WP_000561983.1.87905 WP_000561983.1.8792 WP_000561983.1.87933 WP_000561983.1.87936 WP_000561983.1.87945 WP_000561983.1.87949 WP_000561983.1.87999 WP_000561983.1.8800 WP_000561983.1.88014 WP_000561983.1.88019 WP_000561983.1.88025 WP_000561983.1.88026 WP_000561983.1.8805 WP_000561983.1.88052 WP_000561983.1.8806 WP_000561983.1.88073 WP_000561983.1.8809 WP_000561983.1.88092 WP_000561983.1.881 WP_000561983.1.88136 WP_000561983.1.88145 WP_000561983.1.88165 WP_000561983.1.88174 WP_000561983.1.88185 WP_000561983.1.88199 WP_000561983.1.88214 WP_000561983.1.88222 WP_000561983.1.88244 WP_000561983.1.88264 WP_000561983.1.88275 WP_000561983.1.88291 WP_000561983.1.88293 WP_000561983.1.88299 WP_000561983.1.88303 WP_000561983.1.88313 WP_000561983.1.88356 WP_000561983.1.88359 WP_000561983.1.8837 WP_000561983.1.88393 WP_000561983.1.88407 WP_000561983.1.88414 WP_000561983.1.88423 WP_000561983.1.88444 WP_000561983.1.88446 WP_000561983.1.88458 WP_000561983.1.88474 WP_000561983.1.88483 WP_000561983.1.8849 WP_000561983.1.88501 WP_000561983.1.88508 WP_000561983.1.88538 WP_000561983.1.88547 WP_000561983.1.88597 WP_000561983.1.886 WP_000561983.1.88609 WP_000561983.1.88620 WP_000561983.1.88624 WP_000561983.1.88647 WP_000561983.1.88648 WP_000561983.1.88651 WP_000561983.1.88675 WP_000561983.1.88683 WP_000561983.1.88692 WP_000561983.1.88698 WP_000561983.1.88703 WP_000561983.1.88707 WP_000561983.1.88727 WP_000561983.1.88731 WP_000561983.1.88762 WP_000561983.1.88772 WP_000561983.1.88776 WP_000561983.1.88792 WP_000561983.1.88845 WP_000561983.1.88850 WP_000561983.1.88854 WP_000561983.1.8889 WP_000561983.1.88892 WP_000561983.1.88894 WP_000561983.1.88902 WP_000561983.1.8891 WP_000561983.1.88942 WP_000561983.1.88957 WP_000561983.1.88966 WP_000561983.1.88967 WP_000561983.1.88968 WP_000561983.1.88970 WP_000561983.1.88980 WP_000561983.1.88981 WP_000561983.1.88982 WP_000561983.1.88995 WP_000561983.1.88998 WP_000561983.1.89008 WP_000561983.1.89054 WP_000561983.1.89114 WP_000561983.1.89116 WP_000561983.1.89119 WP_000561983.1.89120 WP_000561983.1.89138 WP_000561983.1.89169 WP_000561983.1.89174 WP_000561983.1.89177 WP_000561983.1.89182 WP_000561983.1.89188 WP_000561983.1.89215 WP_000561983.1.89221 WP_000561983.1.89291 WP_000561983.1.89298 WP_000561983.1.89304 WP_000561983.1.89308 WP_000561983.1.89311 WP_000561983.1.89314 WP_000561983.1.89328 WP_000561983.1.89332 WP_000561983.1.89343 WP_000561983.1.89354 WP_000561983.1.89355 WP_000561983.1.89362 WP_000561983.1.89395 WP_000561983.1.8940 WP_000561983.1.89408 WP_000561983.1.89425 WP_000561983.1.89449 WP_000561983.1.89452 WP_000561983.1.89462 WP_000561983.1.8947 WP_000561983.1.89503 WP_000561983.1.89512 WP_000561983.1.89527 WP_000561983.1.89570 WP_000561983.1.8958 WP_000561983.1.89580 WP_000561983.1.89591 WP_000561983.1.89604 WP_000561983.1.89606 WP_000561983.1.8961 WP_000561983.1.89612 WP_000561983.1.89622 WP_000561983.1.89632 WP_000561983.1.89634 WP_000561983.1.89636 WP_000561983.1.89647 WP_000561983.1.89657 WP_000561983.1.89659 WP_000561983.1.89668 WP_000561983.1.89680 WP_000561983.1.89706 WP_000561983.1.89713 WP_000561983.1.89733 WP_000561983.1.89746 WP_000561983.1.89765 WP_000561983.1.89777 WP_000561983.1.89789 WP_000561983.1.89796 WP_000561983.1.89804 WP_000561983.1.89815 WP_000561983.1.89817 WP_000561983.1.89832 WP_000561983.1.89845 WP_000561983.1.89854 WP_000561983.1.89888 WP_000561983.1.89902 WP_000561983.1.89911 WP_000561983.1.89914 WP_000561983.1.89940 WP_000561983.1.8995 WP_000561983.1.89952 WP_000561983.1.8996 WP_000561983.1.89965 WP_000561983.1.89975 WP_000561983.1.90007 WP_000561983.1.9003 WP_000561983.1.90033 WP_000561983.1.90084 WP_000561983.1.90097 WP_000561983.1.90108 WP_000561983.1.9011 WP_000561983.1.90193 WP_000561983.1.90196 WP_000561983.1.90211 WP_000561983.1.90240 WP_000561983.1.90248 WP_000561983.1.90252 WP_000561983.1.90274 WP_000561983.1.90280 WP_000561983.1.90293 WP_000561983.1.90311 WP_000561983.1.90330 WP_000561983.1.90338 WP_000561983.1.90348 WP_000561983.1.90363 WP_000561983.1.90365 WP_000561983.1.90409 WP_000561983.1.90417 WP_000561983.1.90421 WP_000561983.1.90428 WP_000561983.1.90440 WP_000561983.1.90453 WP_000561983.1.90458 WP_000561983.1.90472 WP_000561983.1.90489 WP_000561983.1.90513 WP_000561983.1.90521 WP_000561983.1.90522 WP_000561983.1.90540 WP_000561983.1.90557 WP_000561983.1.90563 WP_000561983.1.90566 WP_000561983.1.90582 WP_000561983.1.90585 WP_000561983.1.90620 WP_000561983.1.90625 WP_000561983.1.9064 WP_000561983.1.90641 WP_000561983.1.90686 WP_000561983.1.90701 WP_000561983.1.90713 WP_000561983.1.90734 WP_000561983.1.90748 WP_000561983.1.90759 WP_000561983.1.90792 WP_000561983.1.90794 WP_000561983.1.90796 WP_000561983.1.90811 WP_000561983.1.90814 WP_000561983.1.90859 WP_000561983.1.90866 WP_000561983.1.90876 WP_000561983.1.90878 WP_000561983.1.9089 WP_000561983.1.9091 WP_000561983.1.9093 WP_000561983.1.90959 WP_000561983.1.90973 WP_000561983.1.90983 WP_000561983.1.90984 WP_000561983.1.90991 WP_000561983.1.91003 WP_000561983.1.91023 WP_000561983.1.91042 WP_000561983.1.91049 WP_000561983.1.91056 WP_000561983.1.91067 WP_000561983.1.91069 WP_000561983.1.91107 WP_000561983.1.91156 WP_000561983.1.91164 WP_000561983.1.91179 WP_000561983.1.91189 WP_000561983.1.91205 WP_000561983.1.91215 WP_000561983.1.91239 WP_000561983.1.91278 WP_000561983.1.91291 WP_000561983.1.9131 WP_000561983.1.91313 WP_000561983.1.91334 WP_000561983.1.9135 WP_000561983.1.9137 WP_000561983.1.91372 WP_000561983.1.91381 WP_000561983.1.91405 WP_000561983.1.91424 WP_000561983.1.91453 WP_000561983.1.91459 WP_000561983.1.91470 WP_000561983.1.91473 WP_000561983.1.91474 WP_000561983.1.91493 WP_000561983.1.91505 WP_000561983.1.91506 WP_000561983.1.91512 WP_000561983.1.91524 WP_000561983.1.91528 WP_000561983.1.91536 WP_000561983.1.91557 WP_000561983.1.91564 WP_000561983.1.91579 WP_000561983.1.91580 WP_000561983.1.91597 WP_000561983.1.91621 WP_000561983.1.91625 WP_000561983.1.91628 WP_000561983.1.91655 WP_000561983.1.91702 WP_000561983.1.91715 WP_000561983.1.91724 WP_000561983.1.91732 WP_000561983.1.91736 WP_000561983.1.91742 WP_000561983.1.91772 WP_000561983.1.91776 WP_000561983.1.91788 WP_000561983.1.91795 WP_000561983.1.91806 WP_000561983.1.91864 WP_000561983.1.9187 WP_000561983.1.91870 WP_000561983.1.91880 WP_000561983.1.91898 WP_000561983.1.91903 WP_000561983.1.91904 WP_000561983.1.91914 WP_000561983.1.91974 WP_000561983.1.92013 WP_000561983.1.92018 WP_000561983.1.92039 WP_000561983.1.92044 WP_000561983.1.92047 WP_000561983.1.92060 WP_000561983.1.92067 WP_000561983.1.92068 WP_000561983.1.92082 WP_000561983.1.92087 WP_000561983.1.92093 WP_000561983.1.92098 WP_000561983.1.92099 WP_000561983.1.92108 WP_000561983.1.92122 WP_000561983.1.92129 WP_000561983.1.92149 WP_000561983.1.92156 WP_000561983.1.92165 WP_000561983.1.92171 WP_000561983.1.92172 WP_000561983.1.92183 WP_000561983.1.92208 WP_000561983.1.92213 WP_000561983.1.9222 WP_000561983.1.92240 WP_000561983.1.92243 WP_000561983.1.92268 WP_000561983.1.92270 WP_000561983.1.92299 WP_000561983.1.92310 WP_000561983.1.92318 WP_000561983.1.92327 WP_000561983.1.92375 WP_000561983.1.92394 WP_000561983.1.92396 WP_000561983.1.92399 WP_000561983.1.92408 WP_000561983.1.92411 WP_000561983.1.92439 WP_000561983.1.92443 WP_000561983.1.92452 WP_000561983.1.92470 WP_000561983.1.92477 WP_000561983.1.92482 WP_000561983.1.92529 WP_000561983.1.9253 WP_000561983.1.92531 WP_000561983.1.92545 WP_000561983.1.92557 WP_000561983.1.92562 WP_000561983.1.92570 WP_000561983.1.92575 WP_000561983.1.92588 WP_000561983.1.926 WP_000561983.1.92628 WP_000561983.1.92633 WP_000561983.1.92649 WP_000561983.1.92659 WP_000561983.1.92669 WP_000561983.1.92671 WP_000561983.1.92676 WP_000561983.1.92705 WP_000561983.1.9271 WP_000561983.1.92734 WP_000561983.1.92738 WP_000561983.1.92754 WP_000561983.1.92758 WP_000561983.1.92806 WP_000561983.1.92810 WP_000561983.1.92823 WP_000561983.1.92827 WP_000561983.1.92832 WP_000561983.1.92836 WP_000561983.1.92843 WP_000561983.1.92875 WP_000561983.1.92879 WP_000561983.1.92883 WP_000561983.1.92890 WP_000561983.1.92893 WP_000561983.1.92895 WP_000561983.1.92926 WP_000561983.1.92929 WP_000561983.1.92939 WP_000561983.1.92947 WP_000561983.1.92975 WP_000561983.1.92987 WP_000561983.1.92988 WP_000561983.1.93007 WP_000561983.1.93022 WP_000561983.1.93059 WP_000561983.1.93061 WP_000561983.1.93076 WP_000561983.1.93086 WP_000561983.1.93101 WP_000561983.1.93103 WP_000561983.1.93105 WP_000561983.1.93111 WP_000561983.1.93121 WP_000561983.1.93136 WP_000561983.1.93155 WP_000561983.1.93168 WP_000561983.1.93184 WP_000561983.1.93213 WP_000561983.1.93215 WP_000561983.1.93221 WP_000561983.1.93223 WP_000561983.1.93239 WP_000561983.1.93275 WP_000561983.1.93302 WP_000561983.1.93322 WP_000561983.1.93339 WP_000561983.1.93350 WP_000561983.1.9336 WP_000561983.1.93365 WP_000561983.1.93376 WP_000561983.1.93387 WP_000561983.1.93410 WP_000561983.1.93469 WP_000561983.1.93511 WP_000561983.1.93512 WP_000561983.1.93524 WP_000561983.1.93543 WP_000561983.1.93577 WP_000561983.1.93596 WP_000561983.1.93604 WP_000561983.1.93635 WP_000561983.1.93648 WP_000561983.1.93650 WP_000561983.1.93656 WP_000561983.1.93657 WP_000561983.1.93662 WP_000561983.1.93671 WP_000561983.1.93691 WP_000561983.1.937 WP_000561983.1.93705 WP_000561983.1.9374 WP_000561983.1.93741 WP_000561983.1.9375 WP_000561983.1.93754 WP_000561983.1.93761 WP_000561983.1.93767 WP_000561983.1.93780 WP_000561983.1.9380 WP_000561983.1.93803 WP_000561983.1.93804 WP_000561983.1.93809 WP_000561983.1.93828 WP_000561983.1.93837 WP_000561983.1.93842 WP_000561983.1.93843 WP_000561983.1.93875 WP_000561983.1.9389 WP_000561983.1.93909 WP_000561983.1.93919 WP_000561983.1.93937 WP_000561983.1.93938 WP_000561983.1.9394 WP_000561983.1.93956 WP_000561983.1.93984 WP_000561983.1.93986 WP_000561983.1.9399 WP_000561983.1.93994 WP_000561983.1.94017 WP_000561983.1.94039 WP_000561983.1.94056 WP_000561983.1.94064 WP_000561983.1.94070 WP_000561983.1.94072 WP_000561983.1.94079 WP_000561983.1.94097 WP_000561983.1.94107 WP_000561983.1.94132 WP_000561983.1.94142 WP_000561983.1.94162 WP_000561983.1.94168 WP_000561983.1.94181 WP_000561983.1.94198 WP_000561983.1.94215 WP_000561983.1.94303 WP_000561983.1.9432 WP_000561983.1.94352 WP_000561983.1.94354 WP_000561983.1.94365 WP_000561983.1.94379 WP_000561983.1.94380 WP_000561983.1.94383 WP_000561983.1.94390 WP_000561983.1.9440 WP_000561983.1.94412 WP_000561983.1.94415 WP_000561983.1.94458 WP_000561983.1.94473 WP_000561983.1.94492 WP_000561983.1.94510 WP_000561983.1.94527 WP_000561983.1.94557 WP_000561983.1.94562 WP_000561983.1.94565 WP_000561983.1.94573 WP_000561983.1.94579 WP_000561983.1.94584 WP_000561983.1.94586 WP_000561983.1.94588 WP_000561983.1.94593 WP_000561983.1.94598 WP_000561983.1.94622 WP_000561983.1.9463 WP_000561983.1.94649 WP_000561983.1.94650 WP_000561983.1.94655 WP_000561983.1.94659 WP_000561983.1.94662 WP_000561983.1.94669 WP_000561983.1.94670 WP_000561983.1.94674 WP_000561983.1.94700 WP_000561983.1.94717 WP_000561983.1.94745 WP_000561983.1.94782 WP_000561983.1.94785 WP_000561983.1.94796 WP_000561983.1.9481 WP_000561983.1.94815 WP_000561983.1.94817 WP_000561983.1.94820 WP_000561983.1.94835 WP_000561983.1.94849 WP_000561983.1.94850 WP_000561983.1.94851 WP_000561983.1.94862 WP_000561983.1.94864 WP_000561983.1.94921 WP_000561983.1.94947 WP_000561983.1.94952 WP_000561983.1.94959 WP_000561983.1.94967 WP_000561983.1.94971 WP_000561983.1.94982 WP_000561983.1.94983 WP_000561983.1.94986 WP_000561983.1.94987 WP_000561983.1.95006 WP_000561983.1.9503 WP_000561983.1.95051 WP_000561983.1.95055 WP_000561983.1.95076 WP_000561983.1.95085 WP_000561983.1.95094 WP_000561983.1.95099 WP_000561983.1.95121 WP_000561983.1.95136 WP_000561983.1.95152 WP_000561983.1.9516 WP_000561983.1.95165 WP_000561983.1.95171 WP_000561983.1.95235 WP_000561983.1.95239 WP_000561983.1.95246 WP_000561983.1.95248 WP_000561983.1.95249 WP_000561983.1.9525 WP_000561983.1.95255 WP_000561983.1.95265 WP_000561983.1.9527 WP_000561983.1.95277 WP_000561983.1.95282 WP_000561983.1.95289 WP_000561983.1.95298 WP_000561983.1.9530 WP_000561983.1.95320 WP_000561983.1.95338 WP_000561983.1.95388 WP_000561983.1.95404 WP_000561983.1.95412 WP_000561983.1.95434 WP_000561983.1.95447 WP_000561983.1.95456 WP_000561983.1.95465 WP_000561983.1.95530 WP_000561983.1.95546 WP_000561983.1.95547 WP_000561983.1.95558 WP_000561983.1.95579 WP_000561983.1.95590 WP_000561983.1.95607 WP_000561983.1.95623 WP_000561983.1.95625 WP_000561983.1.95630 WP_000561983.1.95641 WP_000561983.1.95656 WP_000561983.1.95670 WP_000561983.1.95675 WP_000561983.1.95691 WP_000561983.1.95701 WP_000561983.1.95703 WP_000561983.1.95716 WP_000561983.1.95729 WP_000561983.1.9574 WP_000561983.1.95744 WP_000561983.1.95757 WP_000561983.1.95776 WP_000561983.1.95803 WP_000561983.1.95805 WP_000561983.1.95826 WP_000561983.1.95840 WP_000561983.1.9586 WP_000561983.1.95866 WP_000561983.1.95884 WP_000561983.1.95890 WP_000561983.1.95901 WP_000561983.1.95906 WP_000561983.1.95911 WP_000561983.1.95939 WP_000561983.1.95940 WP_000561983.1.95963 WP_000561983.1.96004 WP_000561983.1.96025 WP_000561983.1.96042 WP_000561983.1.96044 WP_000561983.1.96045 WP_000561983.1.96054 WP_000561983.1.9609 WP_000561983.1.96094 WP_000561983.1.96107 WP_000561983.1.96127 WP_000561983.1.96139 WP_000561983.1.96141 WP_000561983.1.96144 WP_000561983.1.96162 WP_000561983.1.96172 WP_000561983.1.96188 WP_000561983.1.96190 WP_000561983.1.96206 WP_000561983.1.96211 WP_000561983.1.96212 WP_000561983.1.9624 WP_000561983.1.96260 WP_000561983.1.9627 WP_000561983.1.96317 WP_000561983.1.96319 WP_000561983.1.9633 WP_000561983.1.96335 WP_000561983.1.96340 WP_000561983.1.96343 WP_000561983.1.96348 WP_000561983.1.96349 WP_000561983.1.96359 WP_000561983.1.96380 WP_000561983.1.96404 WP_000561983.1.96429 WP_000561983.1.9644 WP_000561983.1.96469 WP_000561983.1.96490 WP_000561983.1.96497 WP_000561983.1.96500 WP_000561983.1.96521 WP_000561983.1.96533 WP_000561983.1.96537 WP_000561983.1.96539 WP_000561983.1.96552 WP_000561983.1.96555 WP_000561983.1.96563 WP_000561983.1.96584 WP_000561983.1.96588 WP_000561983.1.96590 WP_000561983.1.96600 WP_000561983.1.96610 WP_000561983.1.96625 WP_000561983.1.96635 WP_000561983.1.9664 WP_000561983.1.96640 WP_000561983.1.96642 WP_000561983.1.96662 WP_000561983.1.96675 WP_000561983.1.9670 WP_000561983.1.96721 WP_000561983.1.96732 WP_000561983.1.96735 WP_000561983.1.9674 WP_000561983.1.96750 WP_000561983.1.96758 WP_000561983.1.96761 WP_000561983.1.96771 WP_000561983.1.96792 WP_000561983.1.96798 WP_000561983.1.96801 WP_000561983.1.96803 WP_000561983.1.96810 WP_000561983.1.9686 WP_000561983.1.96876 WP_000561983.1.96890 WP_000561983.1.96902 WP_000561983.1.96917 WP_000561983.1.96925 WP_000561983.1.96938 WP_000561983.1.96946 WP_000561983.1.96957 WP_000561983.1.96978 WP_000561983.1.96993 WP_000561983.1.97005 WP_000561983.1.97015 WP_000561983.1.97026 WP_000561983.1.97028 WP_000561983.1.97043 WP_000561983.1.97047 WP_000561983.1.97079 WP_000561983.1.97089 WP_000561983.1.97103 WP_000561983.1.97143 WP_000561983.1.97145 WP_000561983.1.97154 WP_000561983.1.97184 WP_000561983.1.97190 WP_000561983.1.97224 WP_000561983.1.97260 WP_000561983.1.97287 WP_000561983.1.97291 WP_000561983.1.97297 WP_000561983.1.97318 WP_000561983.1.97322 WP_000561983.1.97328 WP_000561983.1.97337 WP_000561983.1.97368 WP_000561983.1.97369 WP_000561983.1.97386 WP_000561983.1.97413 WP_000561983.1.97422 WP_000561983.1.97441 WP_000561983.1.97477 WP_000561983.1.97480 WP_000561983.1.97487 WP_000561983.1.97496 WP_000561983.1.97497 WP_000561983.1.97505 WP_000561983.1.97534 WP_000561983.1.97547 WP_000561983.1.97594 WP_000561983.1.97597 WP_000561983.1.97599 WP_000561983.1.97604 WP_000561983.1.97606 WP_000561983.1.97613 WP_000561983.1.97615 WP_000561983.1.97620 WP_000561983.1.97626 WP_000561983.1.97628 WP_000561983.1.97631 WP_000561983.1.97640 WP_000561983.1.97646 WP_000561983.1.97648 WP_000561983.1.97656 WP_000561983.1.97690 WP_000561983.1.97691 WP_000561983.1.97693 WP_000561983.1.97704 WP_000561983.1.97725 WP_000561983.1.97726 WP_000561983.1.97727 WP_000561983.1.97732 WP_000561983.1.97736 WP_000561983.1.9774 WP_000561983.1.9775 WP_000561983.1.97768 WP_000561983.1.97772 WP_000561983.1.97800 WP_000561983.1.97819 WP_000561983.1.97840 WP_000561983.1.97846 WP_000561983.1.97873 WP_000561983.1.9793 WP_000561983.1.97938 WP_000561983.1.97981 WP_000561983.1.97983 WP_000561983.1.97986 WP_000561983.1.9799 WP_000561983.1.97991 WP_000561983.1.98006 WP_000561983.1.98019 WP_000561983.1.98022 WP_000561983.1.98036 WP_000561983.1.9805 WP_000561983.1.98080 WP_000561983.1.98086 WP_000561983.1.98107 WP_000561983.1.9811 WP_000561983.1.98110 WP_000561983.1.98119 WP_000561983.1.98124 WP_000561983.1.98146 WP_000561983.1.98158 WP_000561983.1.98170 WP_000561983.1.98201 WP_000561983.1.98219 WP_000561983.1.98236 WP_000561983.1.98250 WP_000561983.1.9826 WP_000561983.1.98263 WP_000561983.1.98314 WP_000561983.1.98338 WP_000561983.1.98392 WP_000561983.1.98402 WP_000561983.1.98403 WP_000561983.1.9841 WP_000561983.1.98418 WP_000561983.1.98438 WP_000561983.1.98440 WP_000561983.1.98446 WP_000561983.1.98448 WP_000561983.1.98457 WP_000561983.1.98472 WP_000561983.1.98483 WP_000561983.1.98495 WP_000561983.1.9850 WP_000561983.1.98502 WP_000561983.1.98513 WP_000561983.1.98531 WP_000561983.1.98551 WP_000561983.1.98570 WP_000561983.1.98577 WP_000561983.1.98607 WP_000561983.1.98608 WP_000561983.1.98627 WP_000561983.1.9863 WP_000561983.1.98634 WP_000561983.1.98676 WP_000561983.1.98677 WP_000561983.1.98726 WP_000561983.1.98731 WP_000561983.1.98751 WP_000561983.1.98760 WP_000561983.1.98762 WP_000561983.1.98763 WP_000561983.1.9877 WP_000561983.1.98779 WP_000561983.1.98801 WP_000561983.1.98818 WP_000561983.1.98843 WP_000561983.1.9887 WP_000561983.1.98899 WP_000561983.1.98931 WP_000561983.1.98947 WP_000561983.1.9898 WP_000561983.1.9899 WP_000561983.1.99040 WP_000561983.1.99057 WP_000561983.1.99071 WP_000561983.1.99072 WP_000561983.1.99083 WP_000561983.1.99097 WP_000561983.1.99098 WP_000561983.1.99107 WP_000561983.1.99163 WP_000561983.1.99164 WP_000561983.1.99184 WP_000561983.1.9919 WP_000561983.1.99197 WP_000561983.1.99198 WP_000561983.1.99215 WP_000561983.1.99219 WP_000561983.1.99255 WP_000561983.1.99267 WP_000561983.1.99276 WP_000561983.1.99278 WP_000561983.1.99320 WP_000561983.1.99327 WP_000561983.1.99335 WP_000561983.1.99339 WP_000561983.1.99350 WP_000561983.1.99360 WP_000561983.1.99363 WP_000561983.1.99369 WP_000561983.1.99370 WP_000561983.1.99388 WP_000561983.1.99397 WP_000561983.1.99456 WP_000561983.1.99463 WP_000561983.1.99469 WP_000561983.1.99483 WP_000561983.1.99490 WP_000561983.1.99493 WP_000561983.1.9954 WP_000561983.1.99546 WP_000561983.1.99561 WP_000561983.1.99577 WP_000561983.1.99579 WP_000561983.1.99595 WP_000561983.1.99613 WP_000561983.1.99626 WP_000561983.1.99630 WP_000561983.1.99637 WP_000561983.1.99646 WP_000561983.1.99657 WP_000561983.1.99660 WP_000561983.1.99671 WP_000561983.1.99676 WP_000561983.1.99712 WP_000561983.1.99725 WP_000561983.1.99747 WP_000561983.1.99764 WP_000561983.1.99783 WP_000561983.1.99813 WP_000561983.1.99824 WP_000561983.1.99829 WP_000561983.1.99837 WP_000561983.1.99841 WP_000561983.1.99858 WP_000561983.1.99889 WP_000561983.1.9992 WP_000561983.1.99924 WP_000561983.1.99958 WP_000561983.1.99961 WP_000561983.1.99996 gi|525838638|ref|YP_008255724.1| gi|378955647|ref|YP_005213134.1| gi|529220083|ref|YP_008381267.1| gi|526219816|ref|YP_008265280.1| gi|383495809|ref|YP_005396498.1| gi|525827058|ref|YP_008249579.1| gi|16759960|ref|NP_455577.1| gi|16764438|ref|NP_460053.1| gi|563652514|ref|YP_008860575.1| gi|379700248|ref|YP_005241976.1| gi|207856424|ref|YP_002243075.1| gi|482902893|ref|YP_007901453.1| gi|538361581|ref|YP_008504866.1| APC23304 gi|386590950|ref|YP_006087350.1| gi|525857264|ref|YP_008260273.1| gi|452120813|ref|YP_007471061.1| gi|197250320|ref|YP_002145948.1| gi|198244755|ref|YP_002215011.1| gi|549478967|ref|YP_008612869.1| gi|378449454|ref|YP_005236813.1| gi|409249466|ref|YP_006885292.1| gi|224584414|ref|YP_002638212.1| gi|378444517|ref|YP_005232149.1| gi|205352234|ref|YP_002226035.1| gi|488654359|ref|YP_007926162.1| gi|525947704|ref|YP_008309146.1| gi|526226908|ref|YP_008321551.1| gi|378983642|ref|YP_005246797.1| gi|194443348|ref|YP_002040281.1| gi|378960012|ref|YP_005217498.1| gi|161614726|ref|YP_001588691.1| 209261.t1841 220341.STY1102 272994.SPAB_02478 423368.SNSL254_A1120 439843.SeSA_A1142 439851.SeD_A1154 454166.SeAg_B1037 454169.SeHA_C1188 476213.SPC_2670 550537.SEN0944 550538.SG0969 99287.STM1079 gi|194737477|ref|YP_002114078.1| gi|29142268|ref|NP_805610.1| gi|525816968|ref|YP_008246986.1| gi|378698975|ref|YP_005180932.1| gi|194449867|ref|YP_002045080.1| ABAK02000001|CDS_484342-484025 ABAM02000001|CDS_1580102-1579785 ABAN01000020|CDS_53487-53804 ABAO01000052|CDS_9542-9225 ABEH02000010|CDS_8703-8386 ABEI01000017|CDS_58757-58440 ABEJ01000009|CDS_53997-53680 ABEL01000010|CDS_102798-102481 ABEW01000012|CDS_35636-35319 ABFF01000014|CDS_109057-109374 ABFG01000013|CDS_102670-102987 ABFH02000002|CDS_976676-976993 AE006468|CDS_1170688-1170371 AE014613|CDS_1901089-1901406 AL513382|CDS_1079724-1079407 AM933172|CDS_1048540-1048223 AM933173|CDS_1057829-1057512 CP000857|CDS_2704578-2704895 CP000886|CDS_2037349-2037666 CP001113|CDS_1131160-1130843 CP001120|CDS_1175413-1175096 CP001127|CDS_1129594-1129277 CP001138|CDS_1040244-1039927 CP001144|CDS_1149167-1148850 CP001363|CDS_1129032-1128715 FN424405|CDS_1167378-1167061 NZ_ACBF01000004|CDS_282410-282727 gi|550900460|ref|YP_008669552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]