SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62389380|ref|YP_224782.1| from Corynebacterium glutamicum ATCC 13032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62389380|ref|YP_224782.1|
Domain Number 1 Region: 335-354,393-630
Classification Level Classification E-value
Superfamily HAD-like 1.77e-37
Family Meta-cation ATPase, catalytic domain P 0.0026
Further Details:      
 
Domain Number 2 Region: 158-242
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.27e-18
Family Calcium ATPase, transduction domain A 0.0066
Further Details:      
 
Domain Number 3 Region: 96-144,245-330
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000122
Family Calcium ATPase, transmembrane domain M 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62389380|ref|YP_224782.1|
Sequence length 650
Comment cation-transporting ATPase [Corynebacterium glutamicum ATCC 13032]
Sequence
MLVRDIFMGDNGVMNKKLNTPNPWMLFIRSFDGIITVAALVAIAIHLILWLALDLDGLAK
NWPLIAIVIVGGIPLMWDVLKSAIKTRGGADTLAAVSIITSVLLGEWLVAAIIVLMLSGG
EALEEAASRRASGTLDALARRAPSTAHRLLGATILDGTEEIAVEEITVGDLVAVLPHELC
PVDGEIVAGHGTMDESYLTGEPYVVSKSKGSQAMSGAVNGDTPLTIVATKLAHDSRYAQI
VGVLHEAENNRPEMRRMADRLGAWYTVIALALGGLGWIVSGDPVRFLAVVVVATPCPLLI
AVPVAIIGAISLAARRGIIVKNPGMLENASGVKTVMFDKTGTLTYGRPVITDIHTAPGVE
EDTVLALAASVERYSRHPLADAIREGAKARELHLPDVVEVSERPGQGLTGTVGEHLVRIT
NRRSTLEIDPDSKNYIPVTSSGMESVVLVDDKYAALIRLRDEPRASASEFIAHLPKKHKV
DKLMIISGDRASEVRYLADKVGIDEVHAEASPEDKLNIVNRHNEHGATMFLGDGINDAPA
MAVATVGVAMGADSDVTSEAADAVILDSSLERLDDLLHISARMRRIALQSAGGGMALSVI
GMILAVFGFLTPLMGAIFQEVIDVLAILNSARVALPRGAISDFDTQEKVS
Download sequence
Identical sequences A0A2H5I602 Q8NT32
gi|62389380|ref|YP_224782.1| gi|62389380|ref|YP_224782.1| NYSGXRC-22047a gi|62389380|ref|YP_224782.1| 196627.cg0569 NP_599727.1.3765 WP_011013685.1.21641 WP_011013685.1.3871 WP_011013685.1.4395 WP_011013685.1.80527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]