SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62390996|ref|YP_226398.1| from Corynebacterium glutamicum ATCC 13032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62390996|ref|YP_226398.1|
Domain Number 1 Region: 105-331
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 4.46e-52
Family MurCDEF 0.0000432
Further Details:      
 
Domain Number 2 Region: 332-483
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 4.27e-41
Family MurCDEF C-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 16-106
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 3.14e-21
Family MurCD N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62390996|ref|YP_226398.1|
Sequence length 486
Comment UDP-N-acetylmuramate--L-alanine ligase [Corynebacterium glutamicum ATCC 13032]
Sequence
MTTPHLDSAQDIDLSRVHLIGIGGAGMSGVARILLARGKTVTGSDAKDSRTLLPLRAVGA
TIAVGHAAENLELSGELPTVVVTSFAAIPQDNPELVRAREEGIPVIRRSDLLGELLEGST
QVLIAGTHGKTSTTSMSVVAMQAAGMDPSFAIGGQLNKAGTNAHHGTGEVFIAEADESDA
SLLRYKPNVAVVTNVEPDHLDFFKTPEAYFQVFDDFAGRITPNGKLVVCLNDPHAAELGE
RSVRKGIKTVGYGTADAVQAHPEVPAMATIVDSQVVAEGTRATINIDGQEVSVILQIPGD
HMVLNGAAALLAGYLVGGDVDKLVEGLSDFSGVRRRFEFHGAIEGGKFNGAAIYDDYAHH
PTEVTAVLSAARTRVKAAGKGRVIVAFQPHLYSRTIEFQKEFAGALSLADAAVVLEIYGA
REQPVDGVSSEIITDAMTIPVVYEPNFSAVPERIAEIAGPNDIVLTMGAGSVTMLAPEIL
DQLQNN
Download sequence
Identical sequences A0A2H5IAF0
gi|530316066|ref|YP_008402030.1| gi|62390996|ref|YP_226398.1| gi|62390996|ref|YP_226398.1| 196627.cg2368 gi|62390996|ref|YP_226398.1| NP_601359.1.3765 WP_011014921.1.21641 WP_011014921.1.3871 WP_011014921.1.4395 WP_011014921.1.80527 WP_011014921.1.91554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]