SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410861786|ref|YP_006977020.1| from Alteromonas macleodii AltDE1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410861786|ref|YP_006977020.1|
Domain Number 1 Region: 223-509
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 7.98e-76
Family Cryptochrome/photolyase FAD-binding domain 0.0000362
Further Details:      
 
Domain Number 2 Region: 10-185
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.35e-29
Family Cryptochrome/photolyase, N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410861786|ref|YP_006977020.1|
Sequence length 543
Comment deoxyribodipyrimidine photolyase [Alteromonas macleodii AltDE1]
Sequence
MLSDNTKPPITIIWLKRDLRLRDHEPLFRAVASNERILLLYCWEPSLIEEPHMSVRHWHF
IQQSIDDINGQLPEHVNVLTLHMEAVDALAFISRFYTINAVRSYQEIGLKVTYNRDLRVA
NYLNNRRIPFLEAKCGAVIRGLPHRAQWQANWEEYFAESTYDYDLKRANWVKWNVHVDIQ
KASLTLSEVSALYAAKKYINKDYLSKYCGVLSEDGLIDFSAMQPGGERRAWQVLKDFFND
RGQYYHQHISKPEYARRACSRLSPYLAWGNISIKQVYQSVQRQKHKKRALPIHEKKRWSR
ALSALTSRLHWHCHFIQKFESEHSIEWRPMNSAYENFPYIDGPEAERRFYHWSIGQTGYP
LVDACMRALRQTGYLNFRMRAMVTSFLCHHLNVHWIKAAHYLATQYLDFEPGIHYPQIQM
QASVTGIHTVRLYNPVSQSKKLDPEGEFIKKWVPELGSLPSDAVHAPYSLLPLEAQMFDF
ALDRDYIAPIVDIAQHNRATAKRLWDYRERDDVIKEAKRIIHRHTMQNSPSRAWFKSKTT
QNH
Download sequence
Identical sequences S5BYM2
gi|410861786|ref|YP_006977020.1| gi|522815821|ref|YP_008184050.1| gi|522614389|ref|YP_008180079.1| WP_015067277.1.24997 WP_015067277.1.30323 WP_015067277.1.68468 WP_015067277.1.96561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]