SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525694234|ref|YP_008232245.1| from Serratia liquefaciens ATCC 27592

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525694234|ref|YP_008232245.1|
Domain Number 1 Region: 2-367
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.43e-110
Family FMN-linked oxidoreductases 0.000000000801
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.42e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000558
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.36e-25
Family C-terminal domain of adrenodoxin reductase-like 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525694234|ref|YP_008232245.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Serratia liquefaciens ATCC 27592]
Sequence
MSNYPHLLAPLDLGFTTLKNRVLMGSMHTGLEELPNGPERMAAFYAERAAAGVALIVTGG
IAPNEKGVVYRGGSTLSHPEQVDHHRIVTDAVHKGGGKIALQILHAGRYSYQPQPVAPSA
LQAPINPFTPTALSEADILQTIADFAQCAALAQQAGYDGVEVMGSEGYLINQFLVARTNQ
RDDQWGGSFSNRMRFAVEIVRAVRQAVGHEFILIYRLSMLDLVEDGSSWQEIEQLALAVE
QAGATIINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVRIPLITTNRINDPAVAEQV
LADGCADMVSMARPFLADAAFVQKAAEGRADEINTCIGCNQACLDQIFEGKLTSCLVNPR
ACRETEMPLVATEKPKKLAVIGAGPAGLAFATTAASRGHRVTLFDAADQIGGQFNIAKQI
PGKEEFHETLRYFRRQLTLQEVDVKLGTWVTAADLAEFDEVILACGIVPRTPAIPGIDNA
KVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQHGVSSSLDPAEFNREWGIDDQLS
QRGGLAVQGPVVARPARQIYLLQRKTSKVGEGLGKTTGWIHRTSLAMRGVKMLNSVNYQR
IDDEGLHISRAEQESCLPVDTVIICAGQEPRRELQQPLLEMGKTVHLIGGADVAAELDAR
RAIDQGTRLAMAL
Download sequence
Identical sequences WP_020831784.1.10966 gi|525694234|ref|YP_008232245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]