SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452209307|ref|YP_007489421.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452209307|ref|YP_007489421.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily GlnB-like 4.13e-33
Family Prokaryotic signal transducing protein 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452209307|ref|YP_007489421.1|
Sequence length 105
Comment Nitrogen regulatory protein P-II [Methanosarcina mazei Tuc01]
Sequence
MQMIRAIIRPGMEPKVVESLEKEGCISLTKMEVFGRGKQKGIHIADVHYDELQKTMLMMV
VEDEHRDRVVQTIMEAARTGKYGDGRIFVNPVEEAYTIRTGKPGL
Download sequence
Identical sequences A0A0E3LRT1 A0A0E3PWD7 A0A0E3RHZ3 A0A0E3RX81 A0A0E3WMX9 F1SVI8 M1QGM5 Q8PYX9
gi|452209307|ref|YP_007489421.1| gi|21226822|ref|NP_632744.1| WP_011032671.1.12270 WP_011032671.1.13133 WP_011032671.1.13782 WP_011032671.1.14209 WP_011032671.1.14583 WP_011032671.1.14776 WP_011032671.1.15587 WP_011032671.1.16483 WP_011032671.1.16878 WP_011032671.1.18729 WP_011032671.1.18783 WP_011032671.1.21267 WP_011032671.1.21501 WP_011032671.1.2157 WP_011032671.1.21629 WP_011032671.1.21918 WP_011032671.1.24179 WP_011032671.1.29103 WP_011032671.1.29761 WP_011032671.1.32345 WP_011032671.1.33522 WP_011032671.1.40449 WP_011032671.1.41322 WP_011032671.1.43564 WP_011032671.1.43834 WP_011032671.1.44090 WP_011032671.1.4739 WP_011032671.1.49674 WP_011032671.1.4970 WP_011032671.1.53089 WP_011032671.1.53770 WP_011032671.1.57580 WP_011032671.1.58691 WP_011032671.1.61041 WP_011032671.1.61670 WP_011032671.1.62876 WP_011032671.1.63409 WP_011032671.1.64722 WP_011032671.1.65224 WP_011032671.1.66913 WP_011032671.1.7135 WP_011032671.1.7314 WP_011032671.1.73216 WP_011032671.1.73711 WP_011032671.1.74065 WP_011032671.1.75484 WP_011032671.1.75785 WP_011032671.1.76299 WP_011032671.1.7642 WP_011032671.1.76508 WP_011032671.1.8229 WP_011032671.1.82623 WP_011032671.1.82674 WP_011032671.1.83034 WP_011032671.1.8430 WP_011032671.1.84394 WP_011032671.1.90340 WP_011032671.1.9066 WP_011032671.1.90871 WP_011032671.1.91617 WP_011032671.1.94933 WP_011032671.1.95514 192952.MM_0720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]