SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452209308|ref|YP_007489422.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452209308|ref|YP_007489422.1|
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily GlnB-like 5.08e-34
Family Prokaryotic signal transducing protein 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452209308|ref|YP_007489422.1|
Sequence length 125
Comment Nitrogen regulatory protein P-II [Methanosarcina mazei Tuc01]
Sequence
MKEITAIIRMNRVQKTKDVLLECGFPSFTVRRVMGRGKQKGLCFEFNPPLPEPEKEAETC
IHFIPKRMFTIVVDDENVNEVVRKIIEVNQTGHPGDGKIFVSSISEAYRIRTGESGEATV
NKEMV
Download sequence
Identical sequences A0A0E3PTJ1 A0A0E3R970 A0A0E3RG43 A0A0E3RKU5 A0A0E3RW35 M1Q1J1 Q8J2Z2
gi|452209308|ref|YP_007489422.1| WP_015411305.1.12270 WP_015411305.1.13133 WP_015411305.1.13782 WP_015411305.1.14209 WP_015411305.1.14583 WP_015411305.1.14776 WP_015411305.1.15587 WP_015411305.1.16483 WP_015411305.1.16878 WP_015411305.1.18729 WP_015411305.1.18783 WP_015411305.1.21267 WP_015411305.1.21501 WP_015411305.1.2157 WP_015411305.1.21629 WP_015411305.1.21918 WP_015411305.1.23878 WP_015411305.1.24179 WP_015411305.1.29103 WP_015411305.1.29761 WP_015411305.1.32345 WP_015411305.1.33522 WP_015411305.1.40449 WP_015411305.1.41322 WP_015411305.1.43564 WP_015411305.1.43834 WP_015411305.1.44090 WP_015411305.1.4739 WP_015411305.1.49674 WP_015411305.1.4970 WP_015411305.1.53089 WP_015411305.1.53770 WP_015411305.1.57580 WP_015411305.1.58691 WP_015411305.1.61041 WP_015411305.1.61670 WP_015411305.1.62876 WP_015411305.1.63409 WP_015411305.1.64722 WP_015411305.1.65224 WP_015411305.1.66913 WP_015411305.1.7135 WP_015411305.1.7314 WP_015411305.1.73216 WP_015411305.1.73711 WP_015411305.1.74065 WP_015411305.1.75484 WP_015411305.1.75785 WP_015411305.1.76299 WP_015411305.1.7642 WP_015411305.1.76508 WP_015411305.1.8229 WP_015411305.1.82623 WP_015411305.1.82674 WP_015411305.1.83034 WP_015411305.1.8430 WP_015411305.1.84394 WP_015411305.1.90340 WP_015411305.1.9066 WP_015411305.1.90871 WP_015411305.1.91617 WP_015411305.1.94933 WP_015411305.1.95514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]