SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452209316|ref|YP_007489430.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452209316|ref|YP_007489430.1|
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily GlnB-like 5.08e-35
Family Prokaryotic signal transducing protein 0.0000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452209316|ref|YP_007489430.1|
Sequence length 114
Comment Nitrogen regulatory protein P-II [Methanosarcina mazei Tuc01]
Sequence
MKYVIAMIRPERLDAVKRELQKIEVSRLTVSSVSGYGAQKGYMEIYRAMEYDANLLEKIK
IEIAVNDEFLEPTIEAIKTGAKGSDGYVGSGKIFVLPLENVIRIRTNETGPEAI
Download sequence
Identical sequences A0A0E3LTM5 A0A0E3LVJ2 A0A0E3PVS3 A0A0E3R9R7 A0A0E3RW28 M1Q7K7 Q8U4U3
WP_015411312.1.12270 WP_015411312.1.13133 WP_015411312.1.13782 WP_015411312.1.14209 WP_015411312.1.14583 WP_015411312.1.14776 WP_015411312.1.15587 WP_015411312.1.16483 WP_015411312.1.16878 WP_015411312.1.18729 WP_015411312.1.18783 WP_015411312.1.21267 WP_015411312.1.21501 WP_015411312.1.2157 WP_015411312.1.21629 WP_015411312.1.21918 WP_015411312.1.23878 WP_015411312.1.24179 WP_015411312.1.29103 WP_015411312.1.29761 WP_015411312.1.32345 WP_015411312.1.33522 WP_015411312.1.40449 WP_015411312.1.41322 WP_015411312.1.43564 WP_015411312.1.43834 WP_015411312.1.44090 WP_015411312.1.4739 WP_015411312.1.49674 WP_015411312.1.4970 WP_015411312.1.53089 WP_015411312.1.53770 WP_015411312.1.57580 WP_015411312.1.58691 WP_015411312.1.61041 WP_015411312.1.61670 WP_015411312.1.62876 WP_015411312.1.63409 WP_015411312.1.64722 WP_015411312.1.65224 WP_015411312.1.66913 WP_015411312.1.7135 WP_015411312.1.7314 WP_015411312.1.73216 WP_015411312.1.73711 WP_015411312.1.74065 WP_015411312.1.75484 WP_015411312.1.75785 WP_015411312.1.76299 WP_015411312.1.7642 WP_015411312.1.76508 WP_015411312.1.8229 WP_015411312.1.82623 WP_015411312.1.82674 WP_015411312.1.83034 WP_015411312.1.8430 WP_015411312.1.84394 WP_015411312.1.90340 WP_015411312.1.9066 WP_015411312.1.90871 WP_015411312.1.91617 WP_015411312.1.94933 WP_015411312.1.95514 gi|452209316|ref|YP_007489430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]