SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452209511|ref|YP_007489625.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452209511|ref|YP_007489625.1|
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily GlnB-like 4.45e-20
Family Prokaryotic signal transducing protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452209511|ref|YP_007489625.1|
Sequence length 120
Comment Nitrogen regulatory protein P-II [Methanosarcina mazei Tuc01]
Sequence
MSDEGDFVLIVTIIKKGWGDEVVKASRKAGAQGGTILYGRGTGIHENKSILGLMIEPEKE
IVLTITESCIADNILKSITEAVKLDEPGTGVGFTVPLEKVFGITRYFCEMQDRSQKSSGS
Download sequence
Identical sequences A0A0E3PUV1 A0A0E3R8Q4 A0A0E3WNS0 A0A0F8Q7P1 M1Q851
WP_015411452.1.12270 WP_015411452.1.13133 WP_015411452.1.13782 WP_015411452.1.14209 WP_015411452.1.14583 WP_015411452.1.14776 WP_015411452.1.15587 WP_015411452.1.16483 WP_015411452.1.16878 WP_015411452.1.18729 WP_015411452.1.18783 WP_015411452.1.21267 WP_015411452.1.21501 WP_015411452.1.2157 WP_015411452.1.21629 WP_015411452.1.21918 WP_015411452.1.24179 WP_015411452.1.29103 WP_015411452.1.29761 WP_015411452.1.32345 WP_015411452.1.33522 WP_015411452.1.40449 WP_015411452.1.41322 WP_015411452.1.43564 WP_015411452.1.43834 WP_015411452.1.44090 WP_015411452.1.4739 WP_015411452.1.4970 WP_015411452.1.53089 WP_015411452.1.53770 WP_015411452.1.57580 WP_015411452.1.58691 WP_015411452.1.61041 WP_015411452.1.61670 WP_015411452.1.63409 WP_015411452.1.64722 WP_015411452.1.65224 WP_015411452.1.66913 WP_015411452.1.7135 WP_015411452.1.7314 WP_015411452.1.73216 WP_015411452.1.73711 WP_015411452.1.74065 WP_015411452.1.75484 WP_015411452.1.75785 WP_015411452.1.76299 WP_015411452.1.76508 WP_015411452.1.8229 WP_015411452.1.82623 WP_015411452.1.83034 WP_015411452.1.8430 WP_015411452.1.84394 WP_015411452.1.9066 WP_015411452.1.90871 WP_015411452.1.91617 WP_015411452.1.94933 WP_015411452.1.95514 gi|452209511|ref|YP_007489625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]