SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452210076|ref|YP_007490190.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452210076|ref|YP_007490190.1|
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.82e-66
Family Phosphate binding protein-like 0.0000685
Further Details:      
 
Domain Number 2 Region: 212-288
Classification Level Classification E-value
Superfamily GlnB-like 1.67e-18
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452210076|ref|YP_007490190.1|
Sequence length 289
Comment ATP phosphoribosyltransferase [Methanosarcina mazei Tuc01]
Sequence
MIRIAIPNKGRLYEPTISIFKDAGLPISGGAESRKLFAKTTDPDIHILFARAADIPEYVQ
DGAADVGITGMDLITERGANVEALLDLKFGRANLVLAVPEDSDFEKAQDLEGKKVATEFP
EITRRYFEKLGVNVNVIKVSGACEMTPHVGIADAIVDISSSGTTLLINHLKAIDMAFSST
VYLIANKESLRTKEKILDIKTAFESVLNAKKKRYLMMNVPESSLQAVKEVLPGMSGPTVM
KVESSKFSEESILAVHAVVDADLIFTIVNRLKKVGARDVLVVPIERIMP
Download sequence
Identical sequences A0A0E3LV41 A0A0E3RVG0 A0A0F8D8E3 M1Q9R4
gi|452210076|ref|YP_007490190.1| WP_015411866.1.13133 WP_015411866.1.14776 WP_015411866.1.15587 WP_015411866.1.16483 WP_015411866.1.16878 WP_015411866.1.18783 WP_015411866.1.21267 WP_015411866.1.21501 WP_015411866.1.21629 WP_015411866.1.21918 WP_015411866.1.24179 WP_015411866.1.29761 WP_015411866.1.32345 WP_015411866.1.40449 WP_015411866.1.41322 WP_015411866.1.44090 WP_015411866.1.4739 WP_015411866.1.4970 WP_015411866.1.53089 WP_015411866.1.57580 WP_015411866.1.58691 WP_015411866.1.61041 WP_015411866.1.61670 WP_015411866.1.63409 WP_015411866.1.65224 WP_015411866.1.66913 WP_015411866.1.7314 WP_015411866.1.73216 WP_015411866.1.73711 WP_015411866.1.74065 WP_015411866.1.75484 WP_015411866.1.76299 WP_015411866.1.76508 WP_015411866.1.8229 WP_015411866.1.82623 WP_015411866.1.82674 WP_015411866.1.83034 WP_015411866.1.8430 WP_015411866.1.84394 WP_015411866.1.90340 WP_015411866.1.9066 WP_015411866.1.90871 WP_015411866.1.91617 WP_015411866.1.94933 WP_015411866.1.95514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]