SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452211516|ref|YP_007491630.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452211516|ref|YP_007491630.1|
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily GlnB-like 1.04e-31
Family Divalent ion tolerance proteins CutA (CutA1) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452211516|ref|YP_007491630.1|
Sequence length 101
Comment Periplasmic divalent cation tolerance protein CutA [Methanosarcina mazei Tuc01]
Sequence
MIGIVYITAGSMDNASEIARELVARRLAACVNMFPIYSIYRWNEKVEEQNEVALFAKTDS
SRLEEIIETVRFLHTYDLPAIEFWEVKGEQDYLDWVHVNSS
Download sequence
Identical sequences A0A0E3LFE0 A0A0E3RB61 A0A0E3S2P5 A0A0E3WN32 A0A0F8K122 M1QDN0
WP_015412981.1.12270 WP_015412981.1.13133 WP_015412981.1.13782 WP_015412981.1.14209 WP_015412981.1.14583 WP_015412981.1.14776 WP_015412981.1.15587 WP_015412981.1.16483 WP_015412981.1.16878 WP_015412981.1.18729 WP_015412981.1.18783 WP_015412981.1.21267 WP_015412981.1.21501 WP_015412981.1.2157 WP_015412981.1.21629 WP_015412981.1.21918 WP_015412981.1.23878 WP_015412981.1.24179 WP_015412981.1.29103 WP_015412981.1.29761 WP_015412981.1.32345 WP_015412981.1.33522 WP_015412981.1.40449 WP_015412981.1.41322 WP_015412981.1.43564 WP_015412981.1.43834 WP_015412981.1.44090 WP_015412981.1.4739 WP_015412981.1.4970 WP_015412981.1.53089 WP_015412981.1.53770 WP_015412981.1.57580 WP_015412981.1.58691 WP_015412981.1.61041 WP_015412981.1.61670 WP_015412981.1.62876 WP_015412981.1.63409 WP_015412981.1.64722 WP_015412981.1.65224 WP_015412981.1.66913 WP_015412981.1.7135 WP_015412981.1.7314 WP_015412981.1.73216 WP_015412981.1.73711 WP_015412981.1.74065 WP_015412981.1.75484 WP_015412981.1.75785 WP_015412981.1.76299 WP_015412981.1.7642 WP_015412981.1.76508 WP_015412981.1.8229 WP_015412981.1.82623 WP_015412981.1.82674 WP_015412981.1.83034 WP_015412981.1.8430 WP_015412981.1.84394 WP_015412981.1.9066 WP_015412981.1.90871 WP_015412981.1.91617 WP_015412981.1.94933 WP_015412981.1.95514 gi|452211516|ref|YP_007491630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]