SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383761117|ref|YP_005440099.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383761117|ref|YP_005440099.1|
Domain Number 1 Region: 99-163
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000445
Family NfeD domain-like 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|383761117|ref|YP_005440099.1|
Domain Number - Region: 27-98
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0719
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383761117|ref|YP_005440099.1|
Sequence length 172
Comment hypothetical protein CLDAP_01620 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MEAQGTEGAGQKHDQEASMVNNEFWMWGWIALAIIFMIAELFTSGFFLFCFGVGAGVAAL
SAYLGLDPFLQIFVFILASGVAVVLTRPIARRLTERTPNFVGSDRVLNRPGVVLIEINPV
LGSGMVRVDAEEWRAVSEDGGVIPKGTIIRVLRIDGTRLVVRPDPGRTLIED
Download sequence
Identical sequences I0HYW4
WP_014431443.1.81527 gi|383761117|ref|YP_005440099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]