SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383762916|ref|YP_005441898.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383762916|ref|YP_005441898.1|
Domain Number 1 Region: 56-145
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.000000000227
Family Sulfiredoxin-like 0.063
Further Details:      
 
Weak hits

Sequence:  gi|383762916|ref|YP_005441898.1|
Domain Number - Region: 220-340
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0105
Family Achaeal helicase C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383762916|ref|YP_005441898.1|
Sequence length 378
Comment hypothetical protein CLDAP_19610 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MPDTQAIQHESLEKFHRNVNKAQIADLMAKITGGKVDLLSYDEVAKRIKSRQQIEMGTQM
IPLDKIVGSVGRYRDFTRTFLPRAGVSPERWARVDAVMNSMEGFPPIEVYKIGDVYFVRD
GNHRVSVARANGLTHIEAYVTEIPTEVPLNMEDFERDRWIIKIERAEFLKETKLDEIRPN
HGIEFTEPGRYQILLRHIQVHQYLRNLDLARAGSDHRLSWEEAVASWYDNVYLPVVEAIR
RHKLLESFPSRTEADLYLWIAHHREQLAKRYGLAPLSPDAAVSTFAEVYSERPLEQAVRT
LKFGLHKALGDLDKPLGMSDEEFAEARARYEAGERSLAEAEREAMHPSDVEKENSTGANE
AAAENGDANCSNEVRMTA
Download sequence
Identical sequences I0I413
gi|383762916|ref|YP_005441898.1| WP_014433236.1.81527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]